product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Mouse Lymphocyte antigen 75
catalog :
MBS1130446
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1130446
products type :
Recombinant Protein
products full name :
Recombinant Mouse Lymphocyte antigen 75
products short name :
Lymphocyte antigen 75
products name syn :
DEC-205; CD205
other names :
lymphocyte antigen 75; Lymphocyte antigen 75; lymphocyte antigen 75; lymphocyte antigen 75; DEC-205; CD_antigen: CD205
products gene name :
Ly75
other gene names :
Ly75; Ly75; CD205; DEC205; DEC-205; Cd205; Ly-75
uniprot entry name :
LY75_MOUSE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
28-211
sequence length :
1723
sequence :
SESSGNDPFTIVHENTGKCIQPLSDWVVAQDCSGTNNML
WKWVSQHRLFHLESQKCLGLDITKATDNLRMFSCDSTVM
LWWKCEHHSLYTAAQYRLALKDGYAVANTNTSDVWKKGG
SEENLCAQPYHEIYTRDGNSYGRPCEFPFLIGETWYHDC
IHDEDHSGPWCATTLSYEYDQKWGICLL
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Acts as an endocytic receptor to direct captured antigens from the extracellular space to a specialized antigen-processing compartment. Causes reduced proliferation of B lymphocytes.
products references :
The receptor DEC-205 expressed by dendritic cells and thymic epithelial cells is involved in antigen processing.Jiang W., Swiggard W.J., Heufler C., Peng M., Mirza A., Steinman R.M., Nussenzweig M.C.Nature 375:151-155(1995) Park C.G., Steinman R.M. DEC-205, a 205-kDa protein abundant on mouse dendritic cells and thymic epithelium that is detected by the monoclonal antibody NLDC-145 purification, characterization, and N-terminal amino acid sequence.Swiggard W.J., Mirza A., Nussenzweig M.C., Steinman R.M.Cell. Immunol. 165:302-311(1995) The mouse C2C12 myoblast cell surface N-linked glycoproteome identification, glycosite occupancy, and membrane orientation.Gundry R.L., Raginski K., Tarasova Y., Tchernyshyov I., Bausch-Fluck D., Elliott S.T., Boheler K.R., Van Eyk J.E., Wollscheid B.Mol. Cell. Proteomics 8:2555-2569(2009) Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.Wollscheid B., Bausch-Fluck D., Henderson C., O'Brien R., Bibel M., Schiess R., Aebersold R., Watts J.D.Nat. Biotechnol. 27:378-386(2009)
ncbi gi num :
148747179
ncbi acc num :
NP_038853.2
ncbi gb acc num :
NM_013825.3
uniprot acc num :
Q60767
ncbi mol weight :
25.2kD
uniprot summary :
LY75: Acts as an endocytic receptor to direct captured antigens from the extracellular space to a specialized antigen- processing compartment. Causes reduced proliferation of B-lymphocytes. 5 isoforms of the human protein are produced by alternative splicing. Protein type: Membrane protein, integral. Cellular Component: external side of plasma membrane; integral to membrane; membrane. Molecular Function: carbohydrate binding. Biological Process: endocytosis
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.2 mg (E-Coli)
price2 :
460
size3 :
0.5 mg (E-Coli)
price3 :
750
size4 :
1 mg (E-Coli)
price4 :
1180
size5 :
1 mg (Yeast)
price5 :
1390
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!