protein

Recombinant Human DNA-directed RNA polymerase III subunit RPC1

MBS1125598

0.05 mg (E-Coli)

190 USD

Recombinant Protein

Recombinant Human DNA-directed RNA polymerase III subunit RPC1

DNA-directed RNA polymerase III subunit RPC1

DNA-directed RNA polymerase III largest subunitDNA-directed RNA polymerase III subunit ARNA polymerase III 155 kDa subunit; RPC155RNA polymerase III subunit C160

DNA-directed RNA polymerase III subunit RPC1; DNA-directed RNA polymerase III subunit RPC1; DNA-directed RNA polymerase III subunit RPC1; polymerase (RNA) III (DNA directed) polypeptide A, 155kDa; DNA-directed RNA polymerase III largest subunit; DNA-directed RNA polymerase III subunit A; RNA polymerase III 155 kDa subunit; RPC155; RNA polymerase III subunit C160

POLR3A

POLR3A; POLR3A; ADDH; HLD7; RPC1; RPC155; hRPC155; RNA polymerase III subunit C1; RPC155

RPC1_HUMAN

E Coli or Yeast or Baculovirus or Mammalian Cell

392-632

1390

FPEKVNKANINFLRKLVQNGPEVHPGANFIQQRHTQMKR
FLKYGNREKMAQELKYGDIVERHLIDGDVVLFNRQPSLH
KLSIMAHLARVKPHRTFRFNECVCTPYNADFDGDEMNLH
LPQTEEAKAEALVLMGTKANLVTPRNGEPLIAAIQDFLT
GAYLLTLKDTFFDRAKACQIIASILVGKDEKIKVRLPPP
TILKPVTLWTGKQIFSVILRPSDDNPVRANLRTKGKQYC
GKGEDLC

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Epigenetics and Nuclear Signaling

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Largest and catalytic core component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. Forms the polymerase active center together with the second largest subunit. A single-stranded DNA template strand of the promoter is positioned within the central active site cleft of Pol III. A bridging helix anates from RPC1 and crosses the cleft near the catalytic site and is thought to promote translocation of Pol III by acting as a ratchet that moves the RNA-DNA hybrid through the active site by switching from straight to bent conformations at each step of nucleotide addition. Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs) induce type I interferon and NF- Kappa-B through the RIG-I pathway.

The largest subunit of human RNA polymerase III is closely related to the largest subunit of yeast and trypanosome RNA polymerase III.Sepehri S., Hernandez N.Genome Res. 7:1006-1019(1997) The DNA sequence and comparative analysis of human chromosome 10.Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J., Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.Nature 429:375-381(2004)

39725938

NP_008986.2

NM_007055.3

O14802

43.34kD

Cytosolic DNA-sensing Pathway (125137); Cytosolic DNA-sensing Pathway (124833); Cytosolic Sensors Of Pathogen-associated DNA Pathway (1269268); Epstein-Barr Virus Infection Pathway (585562); Epstein-Barr Virus Infection Pathway (587115); Gene Expression Pathway (1269649); Immune System Pathway (1269170); Innate Immune System Pathway (1269203); Metabolic Pathways (132956); Purine Metabolism Pathway (82944)

The protein encoded by this gene is the catalytic component of RNA polymerase III, which synthesizes small RNAs. The encoded protein also acts as a sensor to detect foreign DNA and trigger an innate immune response. [provided by RefSeq, Aug 2011]

POLR3A: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Largest and catalytic core component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. Forms the polymerase active center together with the second largest subunit. A single stranded DNA template strand of the promoter is positioned within the central active site cleft of Pol III. A bridging helix emanates from RPC1 and crosses the cleft near the catalytic site and is thought to promote translocation of Pol III by acting as a ratchet that moves the RNA-DNA hybrid through the active site by switching from straight to bent conformations at each step of nucleotide addition. Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs) induce type I interferon and NF- Kappa-B through the RIG-I pathway. Defects in POLR3A are the cause of leukodystrophy hypomyelinating type 7 with or without oligodontia and/or hypogonadotropic hypogonadism (HLD7). An autosomal recessive neurodegenerative disorder characterized by childhood onset of progressive motor decline manifest as spasticity, ataxia, tremor, and cerebellar signs, as well as mild cognitive regression. Other features may include hypodontia or oligodontia and hypogonadotropic hypogonadism. There is considerable inter- and intrafamilial variability. Belongs to the RNA polymerase beta' chain family. Protein type: Nucleotide Metabolism - pyrimidine; Transcription initiation complex; Transferase; EC 2.7.7.6; Nucleotide Metabolism - purine. Chromosomal Location of Human Ortholog: 10q22.3. Cellular Component: cytosol; DNA-directed RNA polymerase III complex; membrane; nucleoplasm. Molecular Function: chromatin binding; DNA binding; DNA-directed RNA polymerase activity; metal ion binding. Biological Process: defense response to virus; gene expression; innate immune response; positive regulation of interferon type I production; positive regulation of interferon-beta production; RNA elongation from RNA polymerase III promoter; termination of RNA polymerase III transcription; transcription from RNA polymerase III promoter; transcription, DNA-dependent. Disease: Leukodystrophy, Hypomyelinating, 7, With Or Without Oligodontia And/or Hypogonadotropic Hypogonadism

0.05 mg (E-Coli)

190 USD

0.2 mg (E-Coli)

460

0.5 mg (E-Coli)

750

1 mg (E-Coli)

1180