catalog number :
MBS1122843
products type :
Recombinant Protein
products full name :
Recombinant Saccharomyces cerevisiae Site-specific recombinase Flp (FLP1)
products short name :
[Site-specific recombinase Flp (FLP1)]
products name syn :
[Site-specific recombinase Flp; FLP; Protein Able]
other names :
[recombinase (FLP); Site-specific recombinase Flp; Protein Able]
products gene name :
[FLP1]
products gene name syn :
[FLP1; R0010W]
other gene names :
[FLP1; FLP]
uniprot entry name :
FLP_YEAST
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[1-423. Full Length]
sequence :
MPQFGILCKTPPKVLVRQFVERFERPSGEKIALCAAELT
YLCWMITHNGTAIKRATFMSYNTIISNSLSFDIVNKSLQ
FKYKTQKATILEASLKKLIPAWEFTIIPYYGQKHQSDIT
DIVSSLQLQFESSEEADKGNSHSKKMLKALLSEGESIWE
ITEKILNSFEYTSRFTKTKTLYQFLFLATFINCGRFSDI
KNVDPKSFKLVQNKYLGVIIQCLVTETKTSVSRHIYFFS
ARGRIDPLVYLDEFLRNSEPVLKRVNRTGNSSSNKQEYQ
LLKDNLVRSYNKALKKNAPYSIFAIKNGPKSHIGRHLMT
SFLSMKGLTELTNVVGNWSDKRASAVARTTYTHQITAIP
DHYFALVSRYYAYDPISKEMIALKDETNPIEEWQHIEQL
KGSAEGSIRYPAWNGIISQEVLDYLSSYINRRI
form :
Liquid containing glycerol
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
image1 heading :
SDS-PAGE
other info1 :
Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
products description :
Part of the plasmid amplification system, which corrects any decrease in copy number caused by a rare missegregation event. Catalyzes the recombination between the large inverted repetitions of the 2-micron plasmid during plasmid replication. This recombination event changes the direction of one of the two replication forks in the bidirectionally replicating molecule, effectively resulting in multiple rounds of replication from a single initiation event. Binds specifically to the FLP recognition target (FRT) site where it induces DNA to bend. Three types of bend exist. Type I is approximately 60 degrees and results from 1 FLP molecule binding to 1 symmetry element. Type II is >144 degrees and results from FLP molecules binding to symmetry elements a and b. Type III is approximately 65 degrees and results from FLP molecules binding to symmetry elements b and c.
ncbi acc num :
NP_040488.1
ncbi gb acc num :
NC_001398.1
ncbi mol weight :
48,620 Da
uniprot summary :
Flp recombinase: Part of the plasmid amplification system, which corrects any decrease in copy number caused by a rare missegregation event. Catalyzes the recombination between the large inverted repetitions of the 2-micron plasmid during plasmid replication. This recombination event changes the direction of one of the two replication forks in the bidirectionally replicating molecule, effectively resulting in multiple rounds of replication from a single initiation event. Binds specifically to the FLP recognition target (FRT) site where it induces DNA to bend. Three types of bend exist. Type I is approximately 60 degrees and results from 1 FLP molecule binding to 1 symmetry element. Type II is 144 degrees and results from FLP molecules binding to symmetry elements a and b. Type III is approximately 65 degrees and results from FLP molecules binding to symmetry elements b and c
size7 :
0.05 mg (Baculovirus)
size9 :
0.05 mg (Mammalian-Cell)
size11 :
0.1 mg (Baculovirus)
size13 :
0.5 mg (Baculovirus)
size14 :
0.1 mg (Mammalian-Cell)
size16 :
1 mg (Baculovirus)