product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Rat G-protein coupled estrogen receptor 1 (Gper)
catalog :
MBS1120624
quantity :
1 mg (E Coli Derived
price :
1775 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1120624
products type :
Recombinant Protein
products full name :
Recombinant Rat G-protein coupled estrogen receptor 1 (Gper)
products short name :
G-protein coupled estrogen receptor 1 (Gper)
products name syn :
Recombinant G-protein coupled estrogen receptor 1 (Gper); G-protein coupled estrogen receptor 1; Chemoattractant receptor-like 2 G-protein coupled receptor 30 G-protein coupled receptor 41 Membrane estrogen receptor; mER
other names :
G-protein coupled estrogen receptor 1; G-protein coupled estrogen receptor 1; G-protein coupled estrogen receptor 1; mER; chemokine receptor-like 2; membrane estrogen receptor; G protein-coupled receptor 30; G-protein coupled receptor 30; G-protein coupled receptor 41; chemoattractant receptor-like 2; G protein-coupled estrogen receptor 1; Chemoattractant receptor-like 2; G-protein coupled receptor 30; G-protein coupled receptor 41; Membrane estrogen receptor
products gene name syn :
Gper; Cmkrl2, Gpr30, Gpr41
other gene names :
Gper; Gper; GPR41; Gpr30; Cmkrl2; Gpr30; Gpr41; mER
uniprot entry name :
GPER_RAT
host :
E Coli or Yeast
sequence positions :
1-375
sequence length :
375
sequence :
MAATTPAQDVGVEIYLGPVWPAPSNSTPLALNLSLALRE
DAPGNLTGDLSEHQQYVIALFLSCLYTIFLFPIGFVGNI
LILVVNISFREKMTIPDLYFINLAAADLILVADSLIEVF
NLDEQYYDIAVLCTFMSLFLQINMYSSVFFLTWMSFDRY
LALAKAMRCGLFRTKHHARLSCGLIWMASVSATLVPFTA
VHLRHTEEACFCFADVREVQWLEVTLGFIVPFAIIGLCY
SLIVRALIRAHRHRGLRPRRQKALRMIFAVVLVFFICWL
PENVFISVHLLQWAQPGDTPCKQSFRHAYPLTGHIVNLA
AFSNSCLSPLIYSFLGETFRDKLRLYVAQKTSLPALNRF
CHATLKAVIPDSTEQSDVKFSSAV
purity :
>90%
form :
This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
other info1 :
Tag Information: His tagged (Host tag may vary. Please inquire for specific tag information). Species: Rattus norvegicus (Rat)
other info2 :
Storage Buffer: PBS pH 7.4, 50% glycerol
ncbi gi num :
19424262
ncbi acc num :
NP_598257.1
ncbi gb acc num :
NM_133573.1
uniprot acc num :
O08878
ncbi mol weight :
42,260 Da
ncbi pathways :
Class A/1 (Rhodopsin-like Receptors) Pathway 574224!!G Alpha (i) Signalling Events Pathway 574252!!GPCR Downstream Signaling Pathway 574250!!GPCR Ligand Binding Pathway 574223!!GPCRs, Class A Rhodopsin-like Pathway 198500!!Peptide Ligand-binding Receptors Pathway 574225!!Signal Transduction Pathway 574116!!Signaling By GPCR Pathway 574222!!Estrogen Signalling Pathway 219761
ncbi summary :
an orphan G protein-coupled receptor found in lung [RGD, Feb 2006]
uniprot summary :
Function: Receptor for estrogen . By similarity. Subcellular location: Cell membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein . By similarity. Golgi apparatus membrane; Multi-pass membrane protein. Note: Protein has been detected in the cell membrane, endoplasmic reticulum and Golgi apparatus. It is currently unclear whether this is a cell surface or intracellular receptor. Ref.2 Ref.3. Tissue specificity: In the paraventricular and supraoptic nuclei of the hypothalamus, expressed in magnocellular neurosecretory cells (MNCs) which secrete oxytocin but not in MNCs which secrete vasopressin (at protein level). Highly expressed in brain and lung, lower expression in heart, skeletal muscle and kidney. Ref.1 Ref.3. Sequence similarities: Belongs to the G-protein coupled receptor 1 family.
size :
1 mg (E Coli Derived)
price :
1775 USD
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!