catalog number :
MBS1120206
products type :
Recombinant Protein
products full name :
Recombinant Bovine coronavirus Hemagglutinin-esterase
products short name :
Hemagglutinin-esterase
products name syn :
E3 glycoprotein
other names :
Hemagglutinin-esterase; Hemagglutinin-esterase; E3 glycoprotein
other gene names :
HE; HE protein
uniprot entry name :
HEMA_CVBM
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
19-424
sequence :
FDNPPTNVVSHLNGDWFLFGDSRSDCNHVVNTNPRNYSY
MDLNPALCDSGKISSKAGNSIFRSFHFTDFYNYTGEGQQ
IIFYEGVNFTPYHAFKCTTSGSNDIWMQNKGLFYTQVYK
NMAVYRSLTFVNVPYVYNGSAQSTALCKSGSLVLNNPAY
IAREANFGDYYYKVEADFYLSGCDEYIVPLCIFNGKFLS
NTKYYDDSQYYFNKDTGVIYGLNSTETITTGFDFNCHYL
VLPSGNYLAISNELLLTVPTK
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Structural protein that makes short spikes at the surface of the virus. Contains receptor binding and receptor-destroying activities. Mediates de-O-acetylation of N-acetyl-9-O-acetylneuraminic acid, which is probably the receptor determinant recognized by the virus on the surface of erythrocytes and susceptible cells. This receptor-destroying activity is important for virus release as it probably helps preventing self-aggregation and ensures the efficient spread of the progeny virus from cell to cell. May serve as a secondary viral attachment protein for initiating infection, the spike protein being the major one. Ses to be a 'luxury' protein that is not absolutely necessary for virus infection in culture. However, its presence in the virus may alter its pathogenicity. May become a target for both the humoral and the cellular branches of the immune system.
products references :
Structure and orientation of expressed bovine coronavirus hemagglutinin-esterase protein.Kienzle T.E., Abraham S., Hogue B.G., Brian D.A.J. Virol. 64:1834-1838(1990)
Structure and expression of the bovine coronavirus hemagglutinin protein.Kienzle T.E., Abraham S., Hogue B.G., Brian D.A.Adv. Exp. Med. Biol. 276:95-102(1990)
Synthesis and processing of the bovine enteric coronavirus haemagglutinin protein.Hogue B.G., Kienzle T.E., Brian D.A.J. Gen. Virol. 70:345-352(1989)
Nidovirus sialate-O-acetylesterases
evolution and substrate specificity of coronaviral and toroviral receptor-destroying enzymes.Smits S.L., Gerwig G.J., van Vliet A.L., Lissenberg A., Briza P., Kamerling J.P., Vlasak R., de Groot R.J.J. Biol. Chem. 280:6933-6941(2005)
Structure of coronavirus hemagglutinin-esterase offers insight into corona and influenza virus evolution.Zeng Q., Langereis M.A., van Vliet A.L., Huizinga E.G., de Groot R.J.Proc. Natl. Acad. Sci. U.S.A. 105:9065-9069(2008)