product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Pesticidal crystal protein cry1Ab
catalog :
MBS1119896
quantity :
0.05 mg (E-Coli)
price :
180 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1119896
products type :
Recombinant Protein
products full name :
Recombinant Pesticidal crystal protein cry1Ab
products short name :
Pesticidal crystal protein cry1Ab
products name syn :
130 kDa crystal protein; Crystaline entomocidal protoxinInsecticidal delta-endotoxin CryIA(b)
other names :
Pesticidal crystal protein Cry1Ab; 130 kDa crystal protein; Crystaline entomocidal protoxin; Insecticidal delta-endotoxin CryIA(b)
products gene name :
cry1Ab
other gene names :
cry1Ab; bt2; cry-1-2; cry1A(b); cryIA(b); cryIC1
uniprot entry name :
CR1AB_BACTK
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
1022-1155; Fragment at the C-terminal.
sequence length :
1155
sequence :
HEIENNTDELKFSNCVEEEVYPNNTVTCNDYTATQEEYE
GTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRD
NPCESNRGYGDYTPLPAGYVTKELEYFPETDKVWIEIGE
TEGTFIVDSVELLLMEE
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae.
products references :
The hypervariable region in the genes coding for entomopathogenic crystal proteins of Bacillus thuringiensis nucleotide sequence of the kurhd1 gene of subsp. kurstaki HD1.Geiser M., Schweitzer S., Grimm C.Gene 48:109-118(1986) Structural similarity between the lepidoptera- and diptera-specific insecticidal endotoxin genes of Bacillus thuringiensis subsp. 'kurstaki' and 'israelensis'.Thorne L., Garduno F., Thompson T., Decker D., Zounes M., Wild M., Walfield A.M., Pollock T.J.J. Bacteriol. 166:801-811(1986) Cloning and nucleotide sequencing of two insecticidal delta-endotoxin genes from Bacillus thuringiensis var. kurstaki HD-1 DNA.Kondo S., Tamura N., Kunitate A., Hattori M., Akashi A., Ohmori I.Agric. Biol. Chem. 51:455-463(1987) Insect tolerant transgenic tomato plants.Fischhoff D.A., Bowdish K.S., Perlak F.J., Marrone P.G., McCormick S.M., Niedermeyer J.G., Dean D.A., Kusano-Kretzmer K., Mayer E.J., Rochester D.E., Rogers S.G., Fraley R.T.Biotechnology (N.Y.) 5:807-813(1987) Sequence of a lepidopteran toxin gene of Bacillus thuringiensis subsp kurstaki NRD-12.Hefford M.A., Brousseau R., Prefontaine G., Hanna Z., Condie J.A., Lau P.C.K.J. Biotechnol. 6:307-322(1987) Characterization of Bacillus thuringiensis subsp. kurstaki strain S93 effective against the Fall armyworm, Spodoptera frugiperda and cloning of a cry1Ab gene.Silva-Werneck J.O., De-Souza M.T., Dias J.M.C.S., Ribeiro B.M.Can. J. Microbiol. 45:464-471(1999)
ncbi gi num :
446291964
ncbi acc num :
WP_000369819.1
uniprot acc num :
P0A370
ncbi mol weight :
31.3kD
size1 :
0.05 mg (E-Coli)
price1 :
180 USD
size2 :
0.05 mg (Yeast)
price2 :
260
size3 :
0.2 mg (E-Coli)
price3 :
490
size4 :
0.2 mg (Yeast)
price4 :
600
size5 :
0.5 mg (E-Coli)
price5 :
715
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!