Recombinant Human Kynurenine 3-monooxygenase | MyBioSource MBS1119330 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Kynurenine 3-monooxygenase

catalog :

MBS1119330

quantity :

0.05 mg (E-Coli)

price :

180 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS1119330

products type :

Recombinant Protein

products full name :

Recombinant Human Kynurenine 3-monooxygenase

products short name :

Kynurenine 3-monooxygenase

products name syn :

Kynurenine 3-hydroxylase

other names :

kynurenine 3-monooxygenase; Kynurenine 3-monooxygenase; kynurenine 3-monooxygenase; kynurenine 3-monooxygenase (kynurenine 3-hydroxylase); Kynurenine 3-hydroxylase

products gene name :

KMO

other gene names :

KMO; KMO; dJ317G22.1

uniprot entry name :

KMO_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

1-486, Full length

sequence length :

486

sequence :

MDSSVIQRKKVAVIGGGLVGSLQACFLAKRNFQIDVYEA
REDTRVATFTRGRSINLALSHRGRQALKAVGLEDQIVSQ
GIPMRARMIHSLSGKKSAIPYGTKSQYILSVSRENLNKD
LLTAAEKYPNVKMHFNHRLLKCNPEEGMITVLGSDKVPK
DVTCDLIVGCDGAYSTVRSHLMKKPRFDYSQQYIPHGYM
ELTIPPKNGDYAMEPNYLHIWPRNTFMMIALPNMNKSFT
CTLFMPFEEFEKLLTSNDVVDFFQKYFPDAIPLIGEKLL
VQDFFLLPAQPMISVKCSSFHFKSHCVLLGDAAHAIVPF
FGQGMNAGFEDCLVFDELMDKFSNDLSLCLPVFSRLRIP
DDHAISDLSMYNYIEMRAHVNSSWFIFQKNMERFLHAIM
PSTFIPLYTMVTFSRIRYHEAVQRWHWQKKVINKGLFFL
GSLIAISSTYLLIHYMSPRSFLRLRRPWNWIAHFRNTTC
FPAKAVDSLEQISNLISR

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Metabolism

products description :

Catalyzes the hydroxylation of L-kynurenine (L-Kyn) to form 3-hydroxy-L-kynurenine (L-3OHKyn). Required for synthesis of quinolinic acid, a neurotoxic NMDA receptor antagonist and potential endogenous inhibitor of NMDA receptor signaling in axonal targeting, synaptogenesis and apoptosis during brain development. Quinolinic acid may also affect NMDA receptor signaling in pancreatic beta cells, osteoblasts, myocardial cells, and the gastrointestinal tract.

products references :

Cloning and functional expression of human kynurenine 3-monooxygenase.Alberati-Giani D., Cesura A.M., Broger C., Warren W.D., Rover S., Malherbe P.FEBS Lett. 410:407-412(1997) Functional characterization and mechanism of action of recombinant human kynurenine 3-hydroxylase.Breton J., Avanzi N., Magagnin S., Covini N., Magistrelli G., Cozzi L., Isacchi A.Eur. J. Biochem. 267:1092-1099(2000) Functional characterization and mechanism of action of recombinant human kynurenine 3-hydroxylase.Breton J., Avanzi N., Magagnin S., Covini N., Magistrelli G., Cozzi L., Isacchi A.Eur. J. Biochem. 267:1092-1099(2000) . The DNA sequence and biological annotation of human chromosome 1.Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K., Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.Nature 441:315-321(2006) Endogenous kynurenines as targets for drug discovery and development.Stone T.W., Darlington L.G.Nat. Rev. Drug Discov. 1:609-620(2002)

ncbi gi num :

187960045

ncbi acc num :

NP_003670.2

ncbi gb acc num :

NM_003679.4

uniprot acc num :

O15229

ncbi mol weight :

71.8kD

ncbi pathways :

Histidine, Lysine, Phenylalanine, Tyrosine, Proline And Tryptophan Catabolism Pathway (1309221); L-kynurenine Degradation Pathway (907939); L-tryptophan Degradation III (eukaryotic) Pathway (139214); L-tryptophan Degradation XI (mammalian, Via Kynurenine) Pathway (139210); L-tryptophan Degradation To 2-amino-3-carboxymuconate Semialdehyde Pathway (139207); Metabolic Pathways (132956); Metabolism Pathway (1269956); Metabolism Of Amino Acids And Derivatives Pathway (1270158); NAD Biosynthesis II (from Tryptophan) Pathway (138368); NAD De Novo Biosynthesis Pathway (142215)

ncbi summary :

This gene encodes a mitochondrion outer membrane protein that catalyzes the hydroxylation of L-tryptophan metabolite, L-kynurenine, to form L-3-hydroxykynurenine. Studies in yeast identified this gene as a therapeutic target for Huntington disease. [provided by RefSeq, Oct 2011]

uniprot summary :

KMO: Catalyzes the hydroxylation of L-kynurenine (L-Kyn) to form 3-hydroxy-L-kynurenine (L-3OHKyn). Required for synthesis of quinolinic acid, a neurotoxic NMDA receptor antagonist and potential endogenous inhibitor of NMDA receptor signaling in axonal targeting, synaptogenesis and apoptosis during brain development. Quinolinic acid may also affect NMDA receptor signaling in pancreatic beta cells, osteoblasts, myocardial cells, and the gastrointestinal tract. Belongs to the aromatic-ring hydroxylase family. KMO subfamily. 3 isoforms of the human protein are produced by alternative splicing. Protein type: Mitochondrial; Amino Acid Metabolism - tryptophan; Oxidoreductase; EC 1.14.13.9; Membrane protein, multi-pass; Membrane protein, integral. Chromosomal Location of Human Ortholog: 1q42-q44. Cellular Component: cytosol; integral to membrane; mitochondrial inner membrane; mitochondrial outer membrane. Molecular Function: FAD binding; kynurenine 3-monooxygenase activity; NAD(P)H oxidase activity. Biological Process: anthranilate metabolic process; NAD metabolic process; quinolinate biosynthetic process; response to salt stress; tryptophan catabolic process; tryptophan catabolic process to kynurenine

size1 :

0.05 mg (E-Coli)

price1 :

180 USD

size2 :

0.05 mg (Yeast)

price2 :

260

size3 :

0.2 mg (E-Coli)

price3 :

490

size4 :

0.2 mg (Yeast)

price4 :

600

size5 :

0.5 mg (E-Coli)

price5 :

715

more info or order :

MyBioSource product webpage