LFVGAALGIELTPWLGFEAEYNQVKGDVDGASAGAEYKQ
KQINGNFYVTSDLITKNYDSKIKPYVLLGAGHYKYDFDG
VNRGTRGTSEEGTLGNAGVGAFWRLNDALSLRTEARATY
NADEEFWNYTALAGLNVVLGGHLKPAAPVVEVAPVEPTP
VTPQPQELTEDLNMELRVFFDTNKSNIKDQYKPEIAKVA
EKLSEYPNATARIEGHTDNTG

San Diego, CA 92195-3308
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!
- Recombinant Bovine coronavirus Hemagglutinin-esterase | MBS1120206
- Recombinant Rat Galectin-3-binding protein | MBS1121268
- Recombinant Macaca mulatta Chemokine CCL20/MIP-3ALPHA | MBS1122916
- Recombinant Human C-type lectin domain family 18 member A | MBS1126756
- Recombinant Mouse Disintegrin and metalloproteinase domain-containing protein 10 ...