product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Pseudomonas syringae pv. tomato (strain DC3000) Thiol:disulfide interchange protein DsbA
catalog :
MBS1114593
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
product information
catalog number :
MBS1114593
products type :
Recombinant Protein
products full name :
Recombinant Pseudomonas syringae pv. tomato (strain DC3000) Thiol:disulfide interchange protein DsbA
products short name :
Thiol:disulfide interchange protein DsbA
other names :
thiol:disulfide interchange protein DsbA; Thiol:disulfide interchange protein DsbA; thiol:disulfide interchange protein DsbA
products gene name :
dsbA
other gene names :
dsbA; dsbA
uniprot entry name :
DSBA_PSESM
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
23-214
sequence length :
214
sequence :
AEPIESGKQYVELTSAVPVAVPGKIEVIELFWYGCPHCY
AFEPTINPWVEKLPSDVNFVRIPAMFGGPWDAHGQLFIT
LDTMGVEHKVHAAVFEAIQKGGKRLTDKNDMADFVATQG
VNKDDFLKTFDSFAVKGKIAQYKELAKKYEVTGVPTMIV
NGKYRFDLGSAGGPEKTLQVADQLIDKERAAAKAAK
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Involved in disulfide-bond formation. Acts by transferring its disulfide bond to other proteins.
products references :
Kloek A.P., Kunkel B.N.The complete genome sequence of the Arabidopsis and tomato pathogen Pseudomonas syringae pv. tomato DC3000.Buell C.R., Joardar V., Lindeberg M., Selengut J., Paulsen I.T., Gwinn M.L., Dodson R.J., DeBoy R.T., Durkin A.S., Kolonay J.F., Madupu R., Daugherty S.C., Brinkac L.M., Beanan M.J., Haft D.H., Nelson W.C., Davidsen T.M., Zafar N., Zhou L., Liu J., Yuan Q., Khouri H.M., Fedorova N.B., Tran B., Russell D., Berry K.J., Utterback T.R., Van Aken S.E., Feldblyum T.V., D'Ascenzo M., Deng W.-L., Ramos A.R., Alfano J.R., Cartinhour S., Chatterjee A.K., Delaney T.P., Lazarowitz S.G., Martin G.B., Schneider D.J., Tang X., Bender C.L., White O., Fraser C.M., Collmer A.Proc. Natl. Acad. Sci. U.S.A. 100:10181-10186(2003)
ncbi gi num :
28867572
ncbi acc num :
NP_790191.1
ncbi gb acc num :
NC_004578.1
uniprot acc num :
O52376
ncbi mol weight :
25.2kD
ncbi pathways :
Cationic Antimicrobial Peptide (CAMP) Resistance Pathway (1186576); Cationic Antimicrobial Peptide (CAMP) Resistance Pathway (1201183)
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.2 mg (E-Coli)
price2 :
460
size3 :
0.5 mg (E-Coli)
price3 :
750
size4 :
0.05 mg (Baculovirus)
price4 :
940
size5 :
0.05 mg (Mammalian-Cell)
price5 :
1160
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!