Recombinant Human 1-acyl-sn-glycerol-3-phosphate acyltransferase beta (AGPAT2) | MyBioSource MBS1113907 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human 1-acyl-sn-glycerol-3-phosphate acyltransferase beta (AGPAT2)

catalog :

MBS1113907

quantity :

INQUIRE

price :

INQUIRE

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS1113907

products type :

Recombinant Protein

products full name :

Recombinant Human 1-acyl-sn-glycerol-3-phosphate acyltransferase beta (AGPAT2)

products short name :

1-acyl-sn-glycerol-3-phosphate acyltransferase beta (AGPAT2)

other names :

1-acyl-sn-glycerol-3-phosphate acyltransferase beta isoform b; 1-acyl-sn-glycerol-3-phosphate acyltransferase beta; 1-acyl-sn-glycerol-3-phosphate acyltransferase beta; 1-AGPAT 2; 1-AGP acyltransferase 2; lysophosphatidic acid acyltransferase beta; lysophosphatidic acid acyltransferase-beta; 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase-beta); 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta); 1-acylglycerol-3-phosphate O-acyltransferase 2; 1-AGP acyltransferase 2; 1-AGPAT 2; Lysophosphatidic acid acyltransferase beta

products gene name syn :

Recombinant 1-acyl-sn-glycerol-3-phosphate acyltransferase beta (AGPAT2); 1-acyl-sn-glycerol-3-phosphate acyltransferase beta EC= 2.3.1.51; 1-acylglycerol-3-phosphate O-acyltransferase 2; 1-AGP acyltransferase 2; 1-AGPAT 2 Lysophosphatidic acid acyltransferase beta; LPAAT-beta

other gene names :

AGPAT2; AGPAT2; BSCL; BSCL1; LPAAB; 1-AGPAT2; LPAAT-beta; 1-AGP acyltransferase 2; 1-AGPAT 2; LPAAT-beta

uniprot entry name :

PLCB_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

24-278

sequence :

MELWPCLAAALLLLLLLVQLSRAAEFYAKVALYCALCFT
VSAVASLVCLLRHGGRTVENMSIIGWFVRSFKYFYGLRF
EVRDPRRLQEARPCVIVSNHQSILDMMGLMEVLPERCVQ
IAKRELLFLGPVGLIMYLGGVFFINRQRSSTAMTVMADL
GERMVRENLKVWIYPEGTRNDNGDLLPFKKGAFYLAVQA
QVPIVPVVYSSFSSFYNTKKKFFTSGTVTVQVLEAIPTS
GLTAADVPALVDTCHRAMRTTFLHISKTPQENGATAGSG
VQPAQ

purity :

>90%(SDS-PAGE)

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C. For extended storage, store at -20 or -80 degree C. Note: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

other info1 :

Species: Homo sapiens (Human)

products description :

Converts lysophosphatidic acid (LPA) into phosphatidic acid by incorporating an acyl moiety at the sn-2 position of the glycerol backbone.

ncbi gi num :

69122971

ncbi acc num :

NP_001012745.1

ncbi gb acc num :

NM_001012727.1

uniprot acc num :

O15120

ncbi mol weight :

47kD

ncbi pathways :

Adipogenesis Pathway (198832); CDP-diacylglycerol Biosynthesis I Pathway (142255); CDP-diacylglycerol Biosynthesis I Pathway (138606); Fat Digestion And Absorption Pathway (194385); Fat Digestion And Absorption Pathway (194324); Fatty Acid, Triacylglycerol, And Ketone Body Metabolism Pathway (160977); Glycerolipid Metabolism Pathway (82986); Glycerolipid Metabolism Pathway (361); Glycerophospholipid Metabolism Pathway (82989); Glycerophospholipid Metabolism Pathway (364)

ncbi summary :

This gene encodes a member of the 1-acylglycerol-3-phosphate O-acyltransferase family. The protein is located within the endoplasmic reticulum membrane and converts lysophosphatidic acid to phosphatidic acid, the second step in de novo phospholipid biosynthesis. Mutations in this gene have been associated with congenital generalized lipodystrophy (CGL), or Berardinelli-Seip syndrome, a disease characterized by a near absence of adipose tissue and severe insulin resistance. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]

uniprot summary :

AGPAT2: Converts lysophosphatidic acid (LPA) into phosphatidic acid by incorporating an acyl moiety at the sn-2 position of the glycerol backbone. Defects in AGPAT2 are the cause of congenital generalized lipodystrophy type 1 (CGL1); also known as Berardinelli-Seip congenital lipodystrophy type 1 (BSCL1) or Berardinelli-Seip syndrome. CGL1 is an autosomal recessive disorder characterized by marked paucity of adipose tissue, extreme insulin resistance, hypertriglyceridemia, hepatic steatosis and early onset of diabetes. Belongs to the 1-acyl-sn-glycerol-3-phosphate acyltransferase family. 2 isoforms of the human protein are produced by alternative splicing. Protein type: EC 2.3.1.51; Lipid Metabolism - ether lipid; Membrane protein, multi-pass; Lipid Metabolism - glycerophospholipid; Membrane protein, integral; Lipid Metabolism - glycerolipid; Transferase. Chromosomal Location of Human Ortholog: 9q34.3. Cellular Component: endoplasmic reticulum membrane; endoplasmic reticulum; integral to membrane. Molecular Function: 1-acylglycerol-3-phosphate O-acyltransferase activity. Biological Process: positive regulation of cytokine production; epidermis development; phospholipid metabolic process; glycerophospholipid biosynthetic process; phosphatidic acid biosynthetic process; triacylglycerol biosynthetic process; cellular lipid metabolic process; positive regulation of cytokine and chemokine mediated signaling pathway; CDP-diacylglycerol biosynthetic process. Disease: Lipodystrophy, Congenital Generalized, Type 1

size1 :

INQUIRE

price1 :

INQUIRE

more info or order :

MyBioSource product webpage