product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Trichosanthes kirilowii Ribosome-inactivating protein alpha-trichosanthin
catalog :
MBS1113428
quantity :
0.01 mg (E-Coli)
price :
235 USD
more info or order :
MyBioSource product webpage
image
image 1 :
MyBioSource MBS1113428 image 1
product information
catalog number :
MBS1113428
products type :
Recombinant Protein
products full name :
Recombinant Trichosanthes kirilowii Ribosome-inactivating protein alpha-trichosanthin
products short name :
[Trichosanthes kirilowii Ribosome-inactivating protein alpha-trichosanthin]
other names :
[Ribosome-inactivating protein alpha-trichosanthin; Ribosome-inactivating protein alpha-trichosanthin; rRNA N-glycosidase]
other gene names :
[Alpha-TCS; Alpha-TCS]
uniprot entry name :
RIPT_TRIKI
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[24-270aa; Full Length of Mature Protein]
sequence length :
270
sequence :
DVSFRLSGATSSSYGVFISNLRKALPNERKLYDIPLLRS
SLPGSQRYALIHLTNYADETISVAIDVTNVYIMGYRAGD
TSYFFNEASATEAAKYVFKDAMRKVTLPYSGNYERLQTA
AGKIRENIPLGLPALDSAITTLFYYNANSAASALMVLIQ
STSEAARYKFIEQQIGKRVDKTFLPSLAIISLENSWSAL
SKQIQIASTNNGQFESPVVLINAQNQRVTITNVDAGVVT
SNIALLLNRNNMA
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
image1 heading :
SDS-Page
other info2 :
Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.
products description :
Inactivates eukaryotic 60S ribosomal subunits.
products references :
Cloning of trichosanthin cDNA and its expression in Escherichia coli.Shaw P.C., Yung M.H., Zhu R.H., Ho W.K.K., Ng T.B., Yeung H.W.Gene 97:267-272(1991) Isolation and DNA sequence of a gene encoding alpha-trichosanthin, a type I ribosome-inactivating protein.Chow T., Feldman R.A., Lovett M., Piatak M.J. Biol. Chem. 265:8670-8674(1990) Primary amino acid sequence of alpha-trichosanthin and molecular models for abrin A-chain and alpha-trichosanthin.Collins E.J., Robertus J.D., Lopresti M., Stone K.L., Williams K.R., Wu P., Hwang K., Piatak M.J. Biol. Chem. 265:8665-8669(1990) Scientific evaluation of Tian Hua Fen (THF) history, chemistry and application.Wang Y., Qian R.Q., Gu Z.W., Jin S.W., Zhang L.Q., Xia Z.X., Tian G.Y., Ni C.Z.Pure Appl. Chem. 58:789-798(1986) Studies on crystal structures, active-centre geometry and depurinating mechanism of two ribosome-inactivating proteins.Huang Q., Liu S., Tang Y., Jin S., Wang Y.Biochem. J. 309:285-298(1995)
ncbi gi num :
132599
ncbi acc num :
P09989.2
uniprot acc num :
P09989
ncbi mol weight :
43.13kD
uniprot summary :
Inactivates eukaryotic 60S ribosomal subunits.
size1 :
0.01 mg (E-Coli)
price1 :
235 USD
size2 :
0.05 mg (E-Coli)
price2 :
320
size3 :
0.1 mg (E-Coli)
price3 :
535
size4 :
0.2 mg (E-Coli)
price4 :
855
size5 :
0.5 mg (E-Coli)
price5 :
1125
size6 :
1 mg (E-Coli)
price6 :
1725
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!