Recombinant Mouse Serine--pyruvate aminotransferase, mitochondrial | MyBioSource MBS1107718 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Mouse Serine--pyruvate aminotransferase, mitochondrial

catalog :

MBS1107718

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS1107718

products type :

Recombinant Protein

products full name :

Recombinant Mouse Serine--pyruvate aminotransferase, mitochondrial

products short name :

Serine--pyruvate aminotransferase

products name syn :

Alanine-glyoxylate aminotransferase (EC:2.6.1.44); AGT

other names :

serine--pyruvate aminotransferase, mitochondrial isoform 1; Serine--pyruvate aminotransferase, mitochondrial; serine--pyruvate aminotransferase, mitochondrial; serine--pyruvate aminotransferase, peroxisomal; alanine-glyoxylate aminotransferase; Alanine--glyoxylate aminotransferase (EC:2.6.1.44); AGT

products gene name :

Agxt

other gene names :

Agxt; Agxt; AGT; SPT; Agt1; Agxt1; Agxt1; SPT; AGT

uniprot entry name :

SPYA_MOUSE

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

25-414

sequence length :

414

sequence :

SYQLLVPPPEALSKPLSVPTRLLLGPGPSNLAPRVLAAG
SLRMIGHMQKEMLQIMEEIKQGIQYVFQTRNPLTLVVSG
SGHCAMETALFNLLEPGDSFLTGTNGIWGMRAAEIADRI
GARVHQMIKKPGEHYTLQEVEEGLAQHKPVLLFLVHGES
STGVVQPLDGFGELCHRYQCLLLVDSVASLGGVPIYMDQ
QGIDIMYSSSQKVLNAPPGISLISFNDKAKYKVYSRKTK
PVSFYTDITYLAKLWGCEGET

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products description :

Dual metabolic roles of gluconeogenesis (in the mitochondria) and glyoxylate detoxification (in the peroxisomes).

products references :

The mouse alanine:glyoxylate aminotransferase gene (Agxt1) cloning, expression, and mapping to chromosome 1.Li X.M., Salido E.C., Shapiro L.J.Somat. Cell Mol. Genet. 25:67-77(1999) Lineage-specific biology revealed by a finished genome assembly of the mouse.Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S., Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C. SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways.Park J., Chen Y., Tishkoff D.X., Peng C., Tan M., Dai L., Xie Z., Zhang Y., Zwaans B.M., Skinner M.E., Lombard D.B., Zhao Y.Mol. Cell 50:919-930(2013) Label-free quantitative proteomics of the lysine acetylome in mitochondria identifies substrates of SIRT3 in metabolic pathways.Rardin M.J., Newman J.C., Held J.M., Cusack M.P., Sorensen D.J., Li B., Schilling B., Mooney S.D., Kahn C.R., Verdin E., Gibson B.W.Proc. Natl. Acad. Sci. U.S.A. 110:6601-6606(2013) Crystal structure of putative aminotransferase (AAH25799.1) from Mus musculus at 1.65 A resolution.Joint center for structural genomics (JCSG) Submitted (OCT-2009) to the PDB data bank

ncbi gi num :

111038130

ncbi acc num :

NP_057911.2

ncbi gb acc num :

NM_016702.3

uniprot acc num :

O35423

ncbi mol weight :

59.3kD

ncbi pathways :

Alanine And Aspartate Metabolism Pathway (198303); Alanine, Aspartate And Glutamate Metabolism Pathway (101155); Alanine, Aspartate And Glutamate Metabolism Pathway (100063); Carbon Metabolism Pathway (815838); Carbon Metabolism Pathway (817567); Glycine, Serine And Threonine Metabolism Pathway (83149); Glycine, Serine And Threonine Metabolism Pathway (313); Glyoxylate And Dicarboxylate Metabolism Pathway (83200); Glyoxylate And Dicarboxylate Metabolism Pathway (383); Glyoxylate Metabolism And Glycine Degradation Pathway (1324442)

uniprot summary :

AGXT: Defects in AGXT are the cause of hyperoxaluria primary type 1 (HP1); also known as primary hyperoxaluria type I (PH1) and oxalosis I. HP1 is a rare autosomal recessive inborn error of glyoxylate metabolism characterized by increased excretion of oxalate and glycolate, and the progressive accumulation of insoluble calcium oxalate in the kidney and urinary tract. Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. Protein type: Amino Acid Metabolism - alanine, aspartate and glutamate; EC 2.6.1.44; Motility/polarity/chemotaxis; Transferase; EC 2.6.1.51; Mitochondrial; Amino Acid Metabolism - glycine, serine and threonine. Cellular Component: mitochondrial matrix; mitochondrion; peroxisomal matrix; peroxisome. Molecular Function: alanine-glyoxylate transaminase activity; amino acid binding; catalytic activity; protein homodimerization activity; protein self-association; pyridoxal phosphate binding; receptor binding; serine-pyruvate transaminase activity; transaminase activity; transferase activity. Biological Process: glycine biosynthetic process, by transamination of glyoxylate; glyoxylate catabolic process; glyoxylate metabolic process; L-alanine catabolic process; L-cysteine catabolic process; Notch signaling pathway; oxalic acid secretion; proteasomal protein catabolic process; pyruvate biosynthetic process; response to cAMP; response to glucocorticoid stimulus

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.05 mg (Yeast)

price2 :

190

size3 :

0.2 mg (E-Coli)

price3 :

460

size4 :

0.2 mg (Yeast)

price4 :

460

size5 :

0.5 mg (Yeast)

price5 :

750

more info or order :

MyBioSource product webpage