product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Macaca mulatta (Rhesus macaque) Myeloid differentiation primary response protein MyD88 (MYD88)
catalog :
MBS1105740
quantity :
1 mg (E-Coli)
price :
1595 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1105740
products type :
Recombinant Protein
products full name :
Recombinant Macaca mulatta (Rhesus macaque) Myeloid differentiation primary response protein MyD88 (MYD88)
products short name :
(Rhesus macaque) Myeloid differentiation primary response protein MyD88 (MYD88)
products name syn :
Recombinant (Rhesus macaque) Myeloid differentiation primary response protein MyD88 (MYD88); Myeloid differentiation primary response protein MyD88
other names :
myeloid differentiation primary response protein MyD88; Myeloid differentiation primary response protein MyD88; myeloid differentiation primary response protein MyD88; myeloid differentiation primary response protein 88
products gene name syn :
MYD88
other gene names :
MYD88; MYD88
uniprot entry name :
MYD88_MACMU
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
1-296
sequence length :
296
sequence :
MAAGGPGTEPAAPVSSTSSLPLAALNMRVRRRLSLFLNV
RTQVAADWTALAEEMDFEYLEIRQLETHADPTGRLLDAW
QGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYI
LKQQQEEAEKPLQVAAVDSSVPRTAELAGITTLDDPLGH
MPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSD
RDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECD
FQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITV
CDYTNPCTKSWFWTRLAKALSLP
purity :
>90%
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
other info1 :
Species: Macaca mulatta (Rhesus macaque)
ncbi gi num :
194595467
ncbi acc num :
NP_001124153.1
ncbi gb acc num :
NM_001130681.1
uniprot acc num :
B3Y683
ncbi mol weight :
33,354 Da
ncbi pathways :
African Trypanosomiasis Pathway (194389); African Trypanosomiasis Pathway (194323); Apoptosis Pathway (86730); Apoptosis Pathway (470); Chagas Disease (American Trypanosomiasis) Pathway (147811); Chagas Disease (American Trypanosomiasis) Pathway (147795); Herpes Simplex Infection Pathway (377876); Herpes Simplex Infection Pathway (377865); Influenza A Pathway (217176); Influenza A Pathway (217150)
uniprot summary :
Function: Adapter protein involved in the Toll-like receptor and IL-1 receptor signaling pathway in the innate immune response. Acts via IRAK1, IRAK2, IRF7 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Increases IL-8 transcription. Involved in IL-18-mediated signaling pathway. Activates IRF1 resulting in its rapid migration into the nucleus to mediate an efficient induction of IFN-beta, NOS2/INOS, and IL12A genes . By similarity. Subunit structure: Homodimer. Also forms heterodimers with TIRAP. Binds to TLR2, TLR4, IRAK1, IRAK2 and IRAK4 via their respective TIR domains. Interacts with IL1RL1. Interacts with IL18R1. Interacts with BMX and IRF7 . By similarity. Interacts with LRRFIP1 and LRRFIP2; this interaction positively regulates Toll-like receptor (TLR) signaling in response to agonist . By similarity. Interacts with FLII . By similarity. LRRFIP1 and LRRFIP2 compete with FLII for MYD88-binding . By similarity. Interacts with IRF1 . By similarity. Subcellular location: Cytoplasm . By similarity. Domain: The intermediate domain (ID) is required for the phosphorylation and activation of IRAK . By similarity. Sequence similarities: Contains 1 death domain.Contains 1 TIR domain.
size1 :
1 mg (E-Coli)
price1 :
1595 USD
size2 :
1 mg (Yeast)
price2 :
2055
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!