product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Rat Solute carrier organic anion transporter family member 1A3 (Slco1a3)
catalog :
MBS1105355
quantity :
1 mg (E Coli Derived
price :
2450 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1105355
products type :
Recombinant Protein
products full name :
Recombinant Rat Solute carrier organic anion transporter family member 1A3 (Slco1a3)
products short name :
Solute carrier organic anion transporter family member 1A3 (Slco1a3)
products name syn :
Recombinant Solute carrier organic anion transporter family member 1A3 (Slco1a3); Solute carrier organic anion transporter family member 1A3; OAT-K2 Sodium-independent organic anion transporter K1; OAT-K1 Solute carrier family 21 member 4 rOAT-K
other names :
solute carrier organic anion transporter family member 1A3; Solute carrier organic anion transporter family member 1A3; solute carrier organic anion transporter family member 1A3; rOAT-K; solute carrier family 21 member 4; sodium-independent organic anion transporter K1; kidney specific organic anion transporter; OAT-K2; Sodium-independent organic anion transporter K1; OAT-K1; Solute carrier family 21 member 4; rOAT-K
products gene name syn :
Slco1a3; Oatp1a3, Slc21a4
other gene names :
Slc21a4; Slco1a3; OAT-K1; OAT-K2; Slco1a3; rOAT-K1; rOAT-K2; rOAT-K3; rOAT-K5; rOAT-K6; rOAT-K7; rOAT-K8; rOAT-K9; rOAT-K11; rOAT-K13; rOAT-K14; Oatp1a3; Slc21a4; OAT-K1
uniprot entry name :
SO1A3_RAT
host :
E Coli or Yeast
sequence positions :
1-670
sequence length :
670
sequence :
MGDLEKGAATHGAGCFAKIKVFLMALTCAYVSKSLSGTF
MSSMLTQIERQFGIPTAIVGFINGSFEIGNLLLIIFVSY
FGMKLHRPIVIGVGCAVMGLGCFIISLPHFLMGRYEYET
TILPTSNLSSNSFLCMENQTQTLNPAQDPAECVKEVKSL
MWIYVLVGNIIRGIGETPIMPLGVSYIENFAKSENSPLY
IGILETGKMIGPIFGLLLGSFCASIYVDTGSVNTDDLTI
TPTDIRWVGAWWIGFLVCAGVNILISIPFFFFPKTLPKE
GLQENVDGTENAKEESTEKRPRKKNRGITKDFFPFLKSP
VLQPDLHAVHPYKVLQVNAFNIYFSFLPKYLENQYGKST
AEVIFLMGVYNLPAICIGYLIAGFMMKKFKITVKTAAFL
AFCLSLSEYSFGFCNFLITCDNVPVAGLTNSYERDQKPL
YLENNVLADCNTRCSCLTKTWDPVCGDNGLAYMSACLAG
CEKSVGTGTNMVFHNCSCIQSPGNSSAVLGLCNKGPECT
NKLQYLLILSGFLSILYSFAAIPGYMVFLRCIKSEEKSL
GIGIHAFCIRVFAGIPAPIYFGALIDRTCLHWGTQKCGA
PGACRMYDINSFRRIYLGMSAALRGSSYLPAFVIVILTR
KFSLPGKINSSEMEIAEMKLTEKESQCTDVHRNPKFKND
GELKTKL
purity :
>90%
form :
This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
other info1 :
Tag Information: His tagged (Host tag may vary. Please inquire for specific tag information). Species: Rattus norvegicus (Rat)
other info2 :
Storage Buffer: PBS pH 7.4, 50% glycerol
ncbi gi num :
13540640
ncbi acc num :
NP_110464.1
ncbi gb acc num :
NM_030837.1
uniprot acc num :
P70502
ncbi mol weight :
73,817 Da
ncbi pathways :
Bile Acid And Bile Salt Metabolism Pathway 368822!!Bile Secretion Pathway 193141!!Bile Secretion Pathway 193095!!Metabolism Of Lipids And Lipoproteins Pathway 368782!!Recycling Of Bile Acids And Salts Pathway 368827!!SLC-mediated Transmembrane Transport Pathway 368844!!Transmembrane Transport Of Small Molecules Pathway 368842!!Transport Of Organic Anions Pathway 368869!!Transport Of Vitamins, Nucleosides, And Related Molecules Pathway 368867
ncbi summary :
plays a role in methotrexate transport; may facilitate basolateral membrane uptake and renal clearance of methotrexate from the blood [RGD, Feb 2006]
uniprot summary :
Function: Mediates the Na+-independent transport of organic anions such as methotrexate, taurocholate, folate and prostaglandin E2. May contribute to renal secretion and/or reabsorption of hydrophobic anionic compounds. Mediates renal clearance of methotrexate from the blood. Subcellular location: Cell membrane; Multi-pass membrane protein. Tissue specificity: All isoforms are detected in kidney, and many are kidney specific. Isoforms 2 and 13 are also detected in liver. Isoforms 4 and 9/K4 are ubiquitous, but isoform 9/K13 is kidney specific. Isoforms 5 and 14 are detected in all tissues tested, with the exception of pancreas and spleen. Isoforms 11 and 15 are detected in kidney, pancreas and testis. Isoform 7 is detected in kidney, liver, testis and spleen. Sequence similarities: Belongs to the organo anion transporter (TC 2.A.60) family. [View classification]Contains 1 Kazal-like domain.
size :
1 mg (E Coli Derived)
price :
2450 USD
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!