Recombinant Human 26S proteasome non-ATPase regulatory subunit 10 | MyBioSource MBS1104315 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human 26S proteasome non-ATPase regulatory subunit 10

catalog :

MBS1104315

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS1104315

products type :

Recombinant Protein

products full name :

Recombinant Human 26S proteasome non-ATPase regulatory subunit 10

products short name :

26S proteasome non-ATPase regulatory subunit 10

products name syn :

26S proteasome regulatory subunit p28; Gankyrin; p28(GANK)

other names :

26S proteasome non-ATPase regulatory subunit 10 isoform 1; 26S proteasome non-ATPase regulatory subunit 10; 26S proteasome non-ATPase regulatory subunit 10; proteasome 26S subunit, non-ATPase 10; 26S proteasome regulatory subunit p28; Gankyrin; p28(GANK)

products gene name :

PSMD10

other gene names :

PSMD10; PSMD10; p28; p28(GANK); dJ889N15.2

uniprot entry name :

PSD10_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

1-226

sequence length :

226

sequence :

MEGCVSNLMVCNLAYSGKLEELKESILADKSLATRTDQD
SRTALHWACSAGHTEIVEFLLQLGVPVNDKDDAGWSPLH
IAASAGRDEIVKALLGKGAQVNAVNQNGCTPLHYAASKN
RHEIAVMLLEGGANPDAKDHYEATAMHRAAAKGNLKMIH
ILLYYKASTNIQDTEGNTPLHLACDEERVEEAKLLVSQG
ASIYIENKEEKTPLQVAKGGLGLILKRMVEG

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Cancer

products description :

Acts as a chaperone during the assembly of the 26S proteasome, specifically of the PA700/19S regulatory complex (RC). In the initial step of the base subcomplex assembly is part of an intermediate PSMD10:PSMC4:PSMC5:PAAF1 module which probably assbles with a PSMD5:PSMC2:PSMC1:PSMD2 module. Independently of the proteasome, regulates EGF-induced AKT activation through inhibition of the RHOA/ROCK/PTEN pahway, leading to prolonged AKT activation. Plays an important role in RAS-induced tumorigenesis. Acts as an proto-oncoprotein by being involved in negative regulation of tumor suppressors RB1 and p53/TP53. Overexpression is leading to phosphorylation of RB1 and proteasomal degradation of RB1. Regulates CDK4-mediated phosphorylation of RB1 by competing with CDKN2A for binding with CDK4. Facilitates binding of MDM2 to p53/TP53 and the mono- and polyubiquitination of p53/TP53 by MDM2 suggesting a function in targeting the TP53:MDM2 complex to the 26S proteasome. Involved in p53-independent apoptosis. Involved in regulation of NF-kappa-B by retaining it in the cytoplasm. Binds to the NF-kappa-B component RELA and accelerates its XPO1/CRM1-mediated nuclear export.

products references :

cDNA cloning and functional analysis of p28 (Nas6p)

ncbi gi num :

4506217

ncbi acc num :

NP_002805.1

ncbi gb acc num :

NM_002814.3

uniprot acc num :

O75832

ncbi mol weight :

40.41kD

ncbi pathways :

APC/C-mediated Degradation Of Cell Cycle Proteins Pathway (1269838); APC/C:Cdc20 Mediated Degradation Of Securin Pathway (1269849); APC/C:Cdc20 Mediated Degradation Of Mitotic Proteins Pathway (1269844); APC/C:Cdh1 Mediated Degradation Of Cdc20 And Other APC/C:Cdh1 Targeted Proteins In Late Mitosis/early G1 Pathway (1269851); APC:Cdc20 Mediated Degradation Of Cell Cycle Proteins Prior To Satisfation Of The Cell Cycle Checkpoint Pathway (1269845); ARMS-mediated Activation Pathway (1269471); AUF1 (hnRNP D0) Binds And Destabilizes MRNA Pathway (1269726); Activation Of APC/C And APC/C:Cdc20 Mediated Degradation Of Mitotic Proteins Pathway (1269842); Activation Of NF-kappaB In B Cells Pathway (1269186); Adaptive Immune System Pathway (1269171)

ncbi summary :

This gene encodes a subunit of the PA700/19S complex, which is the regulatory component of the 26S proteasome. The 26S proteosome complex is required for ubiquitin-dependent protein degradation. This protein is a non-ATPase subunit that may be involved in protein-protein interactions. Aberrant expression of this gene may paly a role in tumorigenesis. Two transcripts encoding different isoforms have been described. Pseudogenes have been identified on chromosomes 3 and 20.[provided by RefSeq, Mar 2011]

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.2 mg (E-Coli)

price2 :

460

size3 :

0.5 mg (E-Coli)

price3 :

750

size4 :

0.05 mg (Baculovirus)

price4 :

980

size5 :

1 mg (E-Coli)

price5 :

1180

more info or order :

MyBioSource product webpage