Recombinant Human Complement C5 | MyBioSource MBS1103026 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Complement C5

catalog :

MBS1103026

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS1103026

products type :

Recombinant Protein

products full name :

Recombinant Human Complement C5

products short name :

Complement C5

products name syn :

C3 and PZP-like alpha-2-macroglobulin domain-containing protein 4

other names :

complement C5 isoform 1 preproprotein; Complement C5; complement C5; complement component 5; C3 and PZP-like alpha-2-macroglobulin domain-containing protein 4

products gene name :

other gene names :

C5; C5; C5D; C5a; C5b; ECLZB; CPAMD4; CPAMD4

uniprot entry name :

CO5_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

678-751

sequence length :

1676

sequence :

TLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAA
RISLGPRCIKAFTECCVVASQLRANISHKDMQLGR

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Signal Transduction

products description :

Activation of C5 by a C5 convertase initiates the spontaneous assembly of the late complent components, C5-C9, into the membrane attack complex. C5b has a transient binding site for C6. The C5b-C6 complex is the foundation upon which the lytic complex is assbled. Derived from proteolytic degradation of complent C5, C5 anaphylatoxin is a mediator of local inflammatory process. Binding to the receptor C5AR1 induces a variety of responses including intracellular calcium release, contraction of smooth muscle, increased vascular permeability, and histamine release from mast cells and basophilic leukocytes. C5a is also a potent chokine which stimulates the locomotion of polymorphonuclear leukocytes and directs their migration toward sites of inflammation.

products references :

Complete cDNA sequence of human complement pro-C5. Evidence of truncated transcripts derived from a single copy gene.Haviland D.L., Haviland J.C., Fleischer D.T., Hunt A., Wetsel R.A.J. Immunol. 146:362-368(1991) SeattleSNPs variation discovery resource

ncbi gi num :

38016947

ncbi acc num :

NP_001726.2

ncbi gb acc num :

NM_001735.2

uniprot acc num :

P01031

ncbi mol weight :

24.27kD

ncbi pathways :

Activation Of C3 And C5 Pathway (1269248); Class A/1 (Rhodopsin-like Receptors) Pathway (1269545); Complement Activation, Classical Pathway (198823); Complement And Coagulation Cascades Pathway (83073); Complement And Coagulation Cascades Pathway (484); Complement Cascade Pathway (1269241); G Alpha (i) Signalling Events Pathway (1269576); GPCR Downstream Signaling Pathway (1269574); GPCR Ligand Binding Pathway (1269544); Herpes Simplex Infection Pathway (377873)

ncbi summary :

This gene encodes a component of the complement system, a part of the innate immune system that plays an important role in inflammation, host homeostasis, and host defense against pathogens. The encoded preproprotein is proteolytically processed to generate multiple protein products, including the C5 alpha chain, C5 beta chain, C5a anaphylatoxin and C5b. The C5 protein is comprised of the C5 alpha and beta chains, which are linked by a disulfide bridge. Cleavage of the alpha chain by a convertase enzyme results in the formation of the C5a anaphylatoxin, which possesses potent spasmogenic and chemotactic activity, and the C5b macromolecular cleavage product, a subunit of the membrane attack complex (MAC). Mutations in this gene cause complement component 5 deficiency, a disease characterized by recurrent bacterial infections. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2015]

uniprot summary :

C5: Activation of C5 by a C5 convertase initiates the spontaneous assembly of the late complement components, C5-C9, into the membrane attack complex. C5b has a transient binding site for C6. The C5b-C6 complex is the foundation upon which the lytic complex is assembled. Defects in C5 are the cause of complement component 5 deficiency (C5D). A rare defect of the complement classical pathway associated with susceptibility to severe recurrent infections, predominantly by Neisseria gonorrhoeae or Neisseria meningitidis. An association study of C5 haplotypes and genotypes in individuals with chronic hepatitis C virus infection shows that individuals homozygous for the C5_1 haplotype have a significantly higher stage of liver fibrosis than individuals carrying at least 1 other allele (PubMed:15995705). Protein type: Secreted; Secreted, signal peptide. Chromosomal Location of Human Ortholog: 9q33-q34. Cellular Component: extracellular region; extracellular space; membrane attack complex. Molecular Function: chemokine activity; endopeptidase inhibitor activity; protein binding; receptor binding. Biological Process: activation of MAPK activity; cell surface receptor linked signal transduction; chemotaxis; complement activation; complement activation, alternative pathway; complement activation, classical pathway; cytolysis; G-protein coupled receptor protein signaling pathway; in utero embryonic development; inflammatory response; innate immune response; positive regulation of angiogenesis; regulation of complement activation; response to stress. Disease: Complement Component 5 Deficiency; Eculizumab, Poor Response To

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.02 mg (Mammalian-Cell)

price2 :

295

size3 :

0.2 mg (E-Coli)

price3 :

460

size4 :

0.05 mg (Mammalian-Cell)

price4 :

575

size5 :

0.5 mg (E-Coli)

price5 :

750

more info or order :

MyBioSource product webpage