catalog number :
MBS1102742
products type :
Recombinant Protein
products full name :
Recombinant Rat Kynurenine 3-monooxygenase
products short name :
Kynurenine 3-monooxygenase
products name syn :
Kynurenine 3-hydroxylase
other names :
kynurenine 3-monooxygenase; Kynurenine 3-monooxygenase; kynurenine 3-monooxygenase; kynurenine 3-monooxygenase (kynurenine 3-hydroxylase); Kynurenine 3-hydroxylase
other gene names :
Kmo; Kmo
uniprot entry name :
KMO_RAT
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
1-384
sequence :
MASSDTEGKRVVVIGGGLVGALNACFLAKRNFQVDVYEA
REDIRVANFMRGRSINLALSYRGRQALKAVGLEDQIVSK
GVPMKARMIHSLSGKKSAIPYGNKSQYILSISREKLNKD
LLTAVESYPNAKVHFGHKLSKCCPEEGILTMLGPNKVPR
DITCDLIVGCDGAYSTVRAHLMKKPRFDYSQQYIPHGYM
ELTIPPKNGEYAMEPNCLHIWPRNAFMMIALPNMDKSFT
CTLFMSFEEFEKLPTHSDVLDFFQKNFPDAIPLMGEQAL
MRDFFLLPAQPMISVKCSPFHLKSRCVLMGDAAHAIVPF
FGQGMNAGFEDCLVFDELMDKFNNDLSVCLPEFSRFRIP
DDHAISDLSMYNYIEMRAHVNSRWFLFQRLLDK
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
other info2 :
Species: Rat
products description :
Catalyzes the hydroxylation of L-kynurenine (L-Kyn) to form 3-hydroxy-L-kynurenine (L-3OHKyn). Required for synthesis of quinolinic acid, a neurotoxic NMDA receptor antagonist and potential endogenous inhibitor of NMDA receptor signaling in axonal targeting, synaptogenesis and apoptosis during brain development. Quinolinic acid may also affect NMDA receptor signaling in pancreatic beta cells, osteoblasts, myocardial cells, and the gastrointestinal tract.
products references :
A radiometric assay for kynurenine 3-hydroxylase based on the release of 3H2O during hydroxylation of L-[3,5-3H]kynurenine." Erickson J.B., Flanagan E.M., Russo S., Reinhard J.F. Jr. Anal. Biochem. 205:257-262(1992)
ncbi acc num :
NP_067604.1
ncbi gb acc num :
NM_021593.1
ncbi mol weight :
59.47kD
ncbi pathways :
Folic Acid Network Pathway (219799); Histidine, Lysine, Phenylalanine, Tyrosine, Proline And Tryptophan Catabolism Pathway (1333469); Metabolic Pathways (132933); Metabolism Pathway (1333271); Metabolism Of Amino Acids And Derivatives Pathway (1333464); Selenium Pathway (219762); Tryptophan Catabolism Pathway (1333474); Tryptophan Metabolism Pathway (83356); Tryptophan Metabolism Pathway (332)
ncbi summary :
human homolog is an NADPH-dependent flavin monooxygenase that catalyzes the hydroxylation of L-kynurenine to form L-3-hydroxykynurenine [RGD, Feb 2006]
uniprot summary :
KMO: Catalyzes the hydroxylation of L-kynurenine (L-Kyn) to form 3-hydroxy-L-kynurenine (L-3OHKyn). Required for synthesis of quinolinic acid, a neurotoxic NMDA receptor antagonist and potential endogenous inhibitor of NMDA receptor signaling in axonal targeting, synaptogenesis and apoptosis during brain development. Quinolinic acid may also affect NMDA receptor signaling in pancreatic beta cells, osteoblasts, myocardial cells, and the gastrointestinal tract. Belongs to the aromatic-ring hydroxylase family. KMO subfamily. 3 isoforms of the human protein are produced by alternative splicing. Protein type: Mitochondrial; Amino Acid Metabolism - tryptophan; Membrane protein, multi-pass; Membrane protein, integral; Oxidoreductase; EC 1.14.13.9. Cellular Component: integral to membrane; mitochondrial inner membrane; mitochondrial outer membrane; mitochondrion. Molecular Function: FAD binding; kynurenine 3-monooxygenase activity; NAD(P)H oxidase activity. Biological Process: anthranilate metabolic process; NAD metabolic process; quinolinate biosynthetic process; response to salt stress; tryptophan catabolic process to kynurenine