product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Bordetella pertussis Serotype 3 fimbrial subunit
catalog :
MBS1098369
quantity :
0.05 mg (E-Coli)
price :
185 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1098369
products type :
Recombinant Protein
products full name :
Recombinant Bordetella pertussis Serotype 3 fimbrial subunit
products short name :
Serotype 3 fimbrial subunit
other names :
serotype 3 fimbrial subunit; Serotype 3 fimbrial subunit; serotype 3 fimbrial subunit
products gene name :
fim3
other gene names :
fim3; fim3
uniprot entry name :
FM3_BORPE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
26-204
sequence length :
204
sequence :
NDGTIVITGSISDQTCVIEEPSTLNHIKVVQLPKISKNA
LRNDGDTAGATPFDIKLKECPQALGALKLYFEPGITTNY
DTGDLIAYKQTYNASGNGNLSTVSSATKAKGVEFRLANL
NGQHIRMGTDKTTQAAQTFTGKVTNGSKSYTLRYLASYV
KKPKEDVDAAQITSYVGFSVVYP
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Bordetella pertussis is the causative agent of whooping cough. An essential step in the disease process is the attachment of the bacteria to the ciliated epithelium of the respiratory tract, enabling the organism to resist normal host-clearance mechanisms. It is unclear which bacterial cell surface component are responsible for adherence but the fimbriae of B. pertussis are prime candidates for being involved in this process.
products references :
Structure of the Bordetella pertussis gene coding for the serotype 3 fimbrial subunit.Mooi F.R., Ter Avest A., van der Heide H.G.J.FEMS Microbiol. Lett. 54:327-331(1990) Comparative analysis of the genome sequences of Bordetella pertussis, Bordetella parapertussis and Bordetella bronchiseptica.Parkhill J., Sebaihia M., Preston A., Murphy L.D., Thomson N.R., Harris D.E., Holden M.T.G., Churcher C.M., Bentley S.D., Mungall K.L., Cerdeno-Tarraga A.-M., Temple L., James K.D., Harris B., Quail M.A., Achtman M., Atkin R., Baker S., Basham D., Bason N., Cherevach I., Chillingworth T., Collins M., Cronin A., Davis P., Doggett J., Feltwell T., Goble A., Hamlin N., Hauser H., Holroyd S., Jagels K., Leather S., Moule S., Norberczak H., O'Neil S., Ormond D., Price C., Rabbinowitsch E., Rutter S., Sanders M., Saunders D., Seeger K., Sharp S., Simmonds M., Skelton J., Squares R., Squares S., Stevens K., Unwin L., Whitehead S., Barrell B.G., Maskell D.J.Nat. Genet. 35:32-40(2003)
ncbi gi num :
33592658
ncbi acc num :
NP_880302.1
ncbi gb acc num :
NC_002929.2
uniprot acc num :
P17835
ncbi mol weight :
35.2kD
ncbi pathways :
Pertussis Pathway (218102); Pertussis Pathway (218099)
size1 :
0.05 mg (E-Coli)
price1 :
185 USD
size2 :
0.2 mg (E-Coli)
price2 :
420
size3 :
0.5 mg (E-Coli)
price3 :
680
size4 :
1 mg (E-Coli)
price4 :
1070
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!