protein

Recombinant Bordetella pertussis Pertussis toxin subunit 1

MBS1095030

0.05 mg (E-Coli)

185 USD

Recombinant Protein

Recombinant Bordetella pertussis Pertussis toxin subunit 1

Pertussis toxin subunit 1

Islet-activating protein S1; IAP S1; NAD-dependent ADP-ribosyltransferase (EC:2.4.2.-)

pertussis toxin subunit 1; Pertussis toxin subunit 1; pertussis toxin subunit 1; Islet-activating protein S1; IAP S1; NAD-dependent ADP-ribosyltransferase (EC:2.4.2.-)

ptxA

ptxA; ptxA; PTX S1; IAP S1

TOX1_BORPE

E Coli or Yeast or Baculovirus or Mammalian Cell

35-269

269

DDPPATVYRYDSRPPEDVFQNGFTAWGNNDNVLDHLTGR
SCQVGSSNSAFVSTSSSRRYTEVYLEHRMQEAVEAERAG
RGTGHFIGYIYEVRADNNFYGAASSYFEYVDTYGDNAGR
ILAGALATYQSEYLAHRRIPPENIRRVTRVYHNGITGET
TTTEYSNARYVSQQTRANPNPYTSRRSVASIVGTLVRMA
PVIGACMARQAESSEAMAAWSERAGEAMVLVYYESIAYS
F

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

S1 is an NAD-dependent ADP-ribosyltransferase, which plays a crucial role in the pathogenesis of B. pertussis causing disruption of normal host cellular regulation. It catalyzes the ADP-ribosylation of a cysteine in the alpha subunit of host heterotrimeric G proteins. In the absence of G proteins it also catalyzes the cleavage of NAD+ into ADP-ribose and nicotinamide. It irreversibly uncouples the G-alpha GTP-binding proteins from their membrane receptors.

Cloning and sequencing of the pertussis toxin genes operon structure and gene duplication.Nicosia A., Perugini M., Franzini C., Casagli M.C., Borri M.G., Antoni G., Almoni M., Neri P., Ratti G., Rappuoli R.Proc. Natl. Acad. Sci. U.S.A. 83:4631-4635(1986) Pertussis toxin gene nucleotide sequence and genetic organization.Locht C., Keith J.M.Science 232:1258-1264(1986) A unique sequence of the Bordetella pertussis toxin operon.Loosmore S.M., Cunningham J.D., Bradley W.R., Yao E.L., Dekaban G.A., Klein M.H.Nucleic Acids Res. 17:8365-8365(1989) Polymorphism in the Bordetella pertussis virulence factors P.69/pertactin and pertussis toxin in The Netherlands temporal trends and evidence for vaccine-driven evolution.Mooi F.R., van Oirschot H., Heuvelman K., van der Heide H.G., Gaastra W., Willems R.J.Infect. Immun. 66:670-675(1998) Intranasal murine model of Bordetella pertussis infection II. Sequence variation and protection induced by a tricomponent acellular vaccine.Boursaux-Eude C., Thiberge S., Carletti G., Guiso N.Vaccine 17:2651-2660(1999) Temporal trends in circulating Bordetella pertussis strains in Australia.Poynten M., McIntyre P.B., Mooi F.R., Heuvelman G.L., Gilbert G.L.Epidemiol. Infect. 132:185-193(2004) Wang Y., Zhang S., Lei D. Bordetella pertussis toxin gene encoding subunit S1.Mallya A.D., Kumar M., Reddy M.N., Seshubabu B., Deobagkar D.D., Kapre S.V. Comparative analysis of the genome sequences of Bordetella pertussis, Bordetella parapertussis and Bordetella bronchiseptica.Parkhill J., Sebaihia M., Preston A., Murphy L.D., Thomson N.R., Harris D.E., Holden M.T.G., Churcher C.M., Bentley S.D., Mungall K.L., Cerdeno-Tarraga A.-M., Temple L., James K.D., Harris B., Quail M.A., Achtman M., Atkin R., Baker S., Basham D., Bason N., Cherevach I., Chillingworth T., Collins M., Cronin A., Davis P., Doggett J., Feltwell T., Goble A., Hamlin N., Hauser H., Holroyd S., Jagels K., Leather S., Moule S., Norberczak H., O'Neil S., Ormond D., Price C., Rabbinowitsch E., Rutter S., Sanders M., Saunders D., Seeger K., Sharp S., Simmonds M., Skelton J., Squares R., Squares S., Stevens K., Unwin L., Whitehead S., Barrell B.G., Maskell D.J.Nat. Genet. 35:32-40(2003) Identification of a region in the S1 subunit of pertussis toxin that is required for enzymatic activity and that contributes to the formation of a neutralizing antigenic determinant.Cieplak W., Burnette W.N., Mar V.L., Kaljot K.T., Morris C.F., Chen K.K., Sato H., Keith J.M.Proc. Natl. Acad. Sci. U.S.A. 85:4667-4671(1988) Identification of an active-site residue in subunit S1 of pertussis toxin by photocrosslinking to NAD.Cockle S.A.FEBS Lett. 249:329-332(1989) Role of tryptophan 26 in the NAD glycohydrolase reaction of the S-1 subunit of pertussis toxin.Cortina G., Barbieri J.T.J. Biol. Chem. 264:17322-17328(1989) Further analysis of the sequence of the S1 subunit of pertussis toxin.Pizza M., Bugnoli M., Puccini P., Siciliano R., Marino G., Rappuoli R.Infect. Immun. 59:1177-1179(1991) A proposed mechanism of ADP-ribosylation catalyzed by the pertussis toxin S1 subunit.Locht C., Antoine R.Biochimie 77:333-340(1995) Synergistic binding of RNA polymerase and BvgA phosphate to the pertussis toxin promoter of Bordetella pertussis.Boucher P.E., Stibitz S.J. Bacteriol. 177:6486-6491(1995) Mutations in the S1 subunit of pertussis toxin that affect secretion.Craig-Mylius K.A., Stenson T.H., Weiss A.A.Infect. Immun. 68:1276-1281(2000) Membrane localization of the S1 subunit of pertussis toxin in Bordetella pertussis and implications for pertussis toxin secretion.Farizo K.M., Fiddner S., Cheung A.M., Burns D.L.Infect. Immun. 70:1193-1201(2002) DsbA and DsbC are required for secretion of pertussis toxin by Bordetella pertussis.Stenson T.H., Weiss A.A.Infect. Immun. 70:2297-2303(2002) Temporal expression of pertussis toxin and Ptl secretion proteins by Bordetella pertussis.Rambow-Larsen A.A., Weiss A.A.J. Bacteriol. 186:43-50(2004) The crystal structure of pertussis toxin.Stein P.E., Boodhoo A., Armstrong G.D., Cockle S.A., Klein M.H., Read R.J.Structure 2:45-57(1994) Crystal structure of the pertussis toxin-ATP complex a molecular sensor.Hazes B., Boodhoo A., Cockle S.A., Read R.J.J. Mol. Biol. 258:661-671(1996)

33594638

NP_882282.1

NC_002929.2

P04977

30.3kD

Pertussis Pathway (218102); Pertussis Pathway (218099); Pertussis Pathogenicity Signature 1, Pertussis Toxin Pathway (704416); Pertussis Pathogenicity Signature 1, Pertussis Toxin Pathway (705375)

0.05 mg (E-Coli)

185 USD

0.2 mg (E-Coli)

420

0.5 mg (E-Coli)

680

1 mg (E-Coli)

1070