product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Escherichia coli Heat-labile enterotoxin B chain
catalog :
MBS1094388
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1094388
products type :
Recombinant Protein
products full name :
Recombinant Escherichia coli Heat-labile enterotoxin B chain
products short name :
Heat-labile enterotoxin B chain
products name syn :
LT-B, human; LTH-B
other names :
enterotoxin; Heat-labile enterotoxin B chain; LT-B, human; LTH-B
products gene name :
eltB
other gene names :
eltB; ltpB
uniprot entry name :
ELBH_ECOLX
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
22-124
sequence length :
124
sequence :
APQSITELCSEYHNTQIYTINDKILSYTESMAGKREMVI
ITFKSGATFQVEVPGSQHIDSQKKAIERMKDTLRITYLT
ETKIDKLCVWNNKTPNSIAAISMEN
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
The biological activity of the toxin is produced by the A chain, which activates intracellular adenyl cyclase.
products references :
Nucleotide sequence comparison between heat-labile toxin B-subunit cistrons from Escherichia coli of human and porcine origin.Leong J., Vinal A.C., Dallas W.S.Infect. Immun. 48:73-77(1985) Germani Y., Desperrier J.-M. A unique amino acid sequence of the B subunit of a heat-labile enterotoxin isolated from a human enterotoxigenic Escherichia coli.Tsuji T., Iida T., Honda T., Miwatani T., Nagahama M., Sakurai J., Wada K., Matsubara H.Microb. Pathog. 2:381-390(1987) Identification of errors among database sequence entries and comparison of correct amino acid sequences for the heat-labile enterotoxins of Escherichia coli and Vibrio cholerae.Domenighini M., Pizza M., Jobling M.G., Holmes R.K., Rappuoli R.Mol. Microbiol. 15:1165-1167(1995) Crystal structure of the B subunit of Escherichia coli heat-labile enterotoxin carrying peptides with anti-herpes simplex virus type 1 activity.Matkovic-Calogovic D., Loregian A., D'Acunto M.R., Battistutta R., Tossi A., Palu G., Zanotti G.J. Biol. Chem. 274:8764-8769(1999)
ncbi gi num :
585223362
ncbi acc num :
WP_024167713.1
ncbi gb acc num :
WP_024167713.1
uniprot acc num :
P0CK94
ncbi mol weight :
15.8kD
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.2 mg (E-Coli)
price2 :
460
size3 :
0.5 mg (E-Coli)
price3 :
750
size4 :
0.05 mg (Baculovirus)
price4 :
835
size5 :
0.05 mg (Mammalian-Cell)
price5 :
1060
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!