ITFKSGATFQVEVPGSQHIDSQKKAIERMKDTLRITYLT
ETKIDKLCVWNNKTPNSIAAISMEN

San Diego, CA 92195-3308
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!
- Recombinant Bordetella pertussis Pertussis toxin subunit 1 | MBS1095030
- Recombinant Loxosceles amazonica Phospholipase D LamSicTox-alphaIC1 | MBS1097017
- Recombinant Mouse Major urinary protein 2 | MBS1097997
- Recombinant Bordetella pertussis Serotype 3 fimbrial subunit | MBS1098369
- Recombinant Human Scrapie-responsive protein 1 | MBS1098477
