protein

Recombinant Human ATP-dependent RNA helicase DDX3X (DDX3X)

MBS1093676

0.5 mg (Baculovirus)

Recombinant Protein

Recombinant Human ATP-dependent RNA helicase DDX3X (DDX3X)

ATP-dependent RNA helicase DDX3X (DDX3X)

ATP-dependent RNA helicase DDX3X; EC=3.6.4.13; DEAD box protein 3, X-chromosomal; DEAD box, X isoform; Helicase-like protein 2; HLP2

ATP-dependent RNA helicase DDX3X isoform 3; ATP-dependent RNA helicase DDX3X; ATP-dependent RNA helicase DDX3X; CAP-Rf; DEAD/H box-3; DEAD box, X isoform; helicase like protein 2; helicase-like protein 2; DEAD box protein 3, X-chromosomal; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 3; DEAD (Asp-Glu-Ala-Asp) box polypeptide 3, X-linked; DEAD (Asp-Glu-Ala-Asp) box helicase 3, X-linked; DEAD box protein 3, X-chromosomal; DEAD box, X isoform; Helicase-like protein 2; HLP2

DDX3X

DDX3X; DBX; DDX3

DDX3X; DDX3X; DBX; DDX3; HLP2; DDX14; DBX; DDX3; HLP2

DDX3X_HUMAN

E Coli or Yeast or Baculovirus or Mammalian Cell

2-662, Full length.

662

SHVAVENALGLDQQFAGLDLNSSDNQSGGSTASKGRYIP
PHLRNREATKGFYDKDSSGWSSSKDKDAYSSFGSRSDSR
GKSSFFSDRGSGSRGRFDDRGRSDYDGIGSRGDRSGFGK
FERGGNSRWCDKSDEDDWSKPLPPSERLEQELFSGGNTG
INFEKYDDIPVEATGNNCPPHIESFSDVEMGEIIMGNIE
LTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFL
LPILSQIYSDGPGEALRAMKENGRYGRRKQYPISLVLAP
TRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDL
ERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRM
LDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQM
LARDFLDEYIFLAVGRVGSTSENITQKVVWVEESDKRSF
LLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACT
SIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDIS
NVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNE
RNINITKDLLDLLVEAKQEVPSWLENMAYEHHYKGSSRG
RSKSSRFSGGFGARDYRQSSGASSSSFSSSRASSSRSGG
GGHGSSRGFGGGGYGGFYNSDGYGGNYNSQGVDWWGN

>90%

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Species: Homo sapiens (Human)

Multifunctional ATP-dependent RNA helicase. The ATPase activity can be stimulated by various ribo- and deoxynucleic acids indicative for a relaxed substrate specificity. In vitro can unwind partially double-stranded DNA with a preference for 5'-single-stranded DNA overhangs. Is involved in several steps of gene expression, such as transcription, mRNA maturation, mRNA export and translation. However, the exact mechanisms are not known and some functions may be specific for a subset of mRNAs. Involved in transcriptional regulation. Can enhance transcription from the CDKN1A/WAF1 promoter in a SP1-dependent manner. Found associated with the E-cadherin promoter and can down-regulate transcription from the promoter. Involved in regulation of translation initiation. Proposed to be involved in positive regulation of translation such as of cyclin E1/CCNE1 mRNA and specifically of mRNAs containing complex secondary structures in their 5'UTRs; these functions seem to require RNA helicase activity. Specifically promotes translation of a subset of viral and cellular mRNAs carrying a 5'proximal stem-loop structure in their 5'UTRs and cooperates with the eIF4F complex. Proposed to act prior to 43S ribosomal scanning and to locally destabilize these RNA structures to allow recognition of the mRNA cap or loading onto the 40S subunit. After association with 40S ribosomal subunits seems to be involved in the functional assembly of 80S ribosomes; the function seems to cover translation of mRNAs with structured and non-structured 5'UTRs and is independent of RNA helicase activity. Also proposed to inhibit cap-dependent translation by competetive interaction with EIF4E which can block the EIF4E:EIF4G complex formation. Proposed to be involved in stress response and stress granule assembly; the function is independent of RNA helicase activity and seems to involve association with EIF4E. May be involved in nuclear export of specific mRNAs but not in bulk mRNA export via interactions with XPO1 and NXF1. Also associates with polyadenylated mRNAs independently of NXF1. Associates with spliced mRNAs in an exon junction complex (EJC)-dependent manner and seems not to be directly involved in splicing. May be involved in nuclear mRNA export by association with DDX5 and regulating its nuclear location. Involved in innate immune signaling promoting the production of type I interferon (IFN-alpha and IFN-beta); proposed to act as viral RNA sensor, signaling intermediate and transcriptional coactivator. Involved in TBK1 and IKBKE-dependent IRF3 activation leading to IFNB induction, plays a role of scaffolding adapter that links IKBKE and IRF3 and coordinates their activation. Also found associated with IFNB promoters; the function is independent of IRF3. Can bind to viral RNAs and via association with MAVS/IPS1 and DDX58/RIG-I is thought to induce signaling in early stages of infection. Involved in regulation of apoptosis. May be required for activation of the intrinsic but inhibit activation of the extrinsic apoptotic pathway. Acts as an antiapoptotic protein through association with GSK3A/B and BIRC2 in an apoptosis antagonizing signaling complex; activation of death receptors promotes caspase-dependent cleavage of BIRC2 and DDX3X and relieves the inhibition. May be involved in mitotic chromosome segregation. Appears to be a prime target for viral manipulations. Hepatitis B virus (HBV) polymerase and possibly vaccinia virus (VACV) protein K7 inhibit IFNB induction probably by dissociating DDX3X from TBK1 or IKBKE. Is involved in hepatitis C virus (HCV) replication; the function may involve the association with HCV core protein. HCV core protein inhibits the IPS1-dependent function in viral RNA sensing and may switch the function from a INFB inducing to a HCV replication mode. Involved in HIV-1 replication. Acts as a cofactor for XPO1-mediated nuclear export of incompletely spliced HIV-1 Rev RNAs.

301171475

NP_001180346.1

NM_001193417.1

O00571

90kD

Hepatitis B Pathway (694606); RIG-I-like Receptor Signaling Pathway (117292); RIG-I-like Receptor Signaling Pathway (116128); TNF-alpha/NF-kB Signaling Pathway (198884); Viral Carcinogenesis Pathway (658418); Viral Carcinogenesis Pathway (662842)

DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which interacts specifically with hepatitis C virus core protein resulting a change in intracellular location. This gene has a homolog located in the nonrecombining region of the Y chromosome. The protein sequence is 91% identical between this gene and the Y-linked homolog. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Jul 2010]

DDX3: a multifunctional DEAD box family RNA helicase with diverse cellular functions. DEAD box proteins are characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), and are involved in several steps of gene expression, such as transcription, maturation of nuclear and mitochondrial mRNA, mRNA export, translation initiation, and ribosome and spliceosome assembly. DDX3 is required for nuclear export of HIV-1 viral transcripts, possibly in a complex with the viral Rev protein and host cofactor CRM1. DDX3 is required for hepatitis C virus (HCV) RNA replication and its expression is downregulated in hepatitis B virus (HBV) associated hepatocellular carcinoma (HCC). May function as a tumor suppressor protein. Its expression inhibits tumor cell colony formation and increases expression of the cdk inhibitor p21 Waf1/Cip1. Low DDX3 expression has been shown in HCC, and aberrant subcellular localization occurs in many squamous cell carcinomas. Reduced DDX3 expression in cultured cells causes a diminished dependence on serum for cell proliferation and changes in cyclin D1 and p21 Waf1/Cip1 expression. Associates with eIF4F to promote translation of selected mRNAs. Is phosphorylated by the mitotic cyclin dependent kinase, cyclin B/cdc2. This phosphorylation may cause a loss of DDX3 function and a concomitant repression of ribosome biogenesis and translation in mitosis. Involved in TBK1 and IKBKE-dependent IRF3 activation leading to IFN-beta induction. Involved in regulation of apoptosis. May be required for activation of the intrinsic but inhibit activation of the extrinsic apoptotic pathway. Regulated by the cell cycle. Maximally expressed in the cytoplasm during G1/S phase and decreased expression during G2/M phase. Located predominantly in nuclear speckles and, at low levels, throughout the cytoplasm. Associates with the outer side of nuclear pore complexes (NPC) and mitochondrial outer membranes. Shuttles between the nucleus and the cytoplasm in an exportin1-dependent manner. Associates with polyadenylated mRNAs in the cytoplasm and the nucleus. Predominantly located in nucleus during G0 phase and in the cytoplasm during G1/S phase. Belongs to the DEAD box helicase family, DDX3 subfamily. Two isoforms of the human protein are produced by alternative splicing. Protein type: RNA-binding; Translation initiation; EC 3.6.4.13; Cell cycle regulation; Helicase; Spliceosome. Chromosomal Location of Human Ortholog: Xp11.3-p11.23. Cellular Component: eukaryotic translation initiation factor 3 complex; mitochondrial outer membrane; stress granule; cytoplasm; nuclear speck; nucleus. Molecular Function: GTPase activity; CTPase activity; RNA binding; ATPase activity; transcription factor binding; poly(A) binding; ATP-dependent DNA helicase activity; protein binding; DNA binding; translation initiation factor binding; eukaryotic initiation factor 4E binding; nucleoside-triphosphatase activity; mRNA 5 -UTR binding; ribosomal small subunit binding; ATP-dependent RNA helicase activity; ATP binding. Biological Process: stress granule assembly; positive regulation of viral genome replication; transcription, DNA-dependent; positive regulation of translation; viral reproduction; positive regulation of apoptosis; response to virus; positive regulation of caspase activity; negative regulation of caspase activity; positive regulation of cell growth; DNA duplex unwinding; chromosome segregation; positive regulation of translational initiation; induction of apoptosis via death domain receptors; negative regulation of translation; RNA secondary structure unwinding; positive regulation of interferon-beta production; innate immune response; positive regulation of transcription from RNA polymerase II promoter; negative regulation of cell growth; negative regulation of protein complex assembly; mature ribosome assembly; negative regulation of apoptosis. Disease: Mental Retardation, X-linked 102

0.5 mg (Baculovirus)

0.05 mg (Baculovirus)

0.5 mg (E-Coli)

0.1 mg (Mammalian-Cell)

0.1 mg (Baculovirus)