product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 4
catalog :
MBS1093051
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1093051
products type :
Recombinant Protein
products full name :
Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 4
products short name :
Carcinoembryonic antigen-related cell adhesion molecule 4
products name syn :
Carcinoembryonic antigen CGM7; Non-specific cross-reacting antigen W236
other names :
carcinoembryonic antigen-related cell adhesion molecule 4; Carcinoembryonic antigen-related cell adhesion molecule 4; carcinoembryonic antigen-related cell adhesion molecule 4; carcinoembryonic antigen related cell adhesion molecule 4; Carcinoembryonic antigen CGM7; Non-specific cross-reacting antigen W236
products gene name :
CEACAM4
other gene names :
CEACAM4; CEACAM4; NCA; CGM7; CGM7_HUMAN; CGM7
uniprot entry name :
CEAM4_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
36-155
sequence length :
244
sequence :
FTIEALPSSAAEGKDVLLLACNISETIQAYYWHKGKTAE
GSPLIAGYITDIQANIPGAAYSGRETVYPNGSLLFQNIT
LEDAGSYTLRTINASYDSDQATGQLHVHQNNVPGLPVGA
VAG
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products categories :
Immunology
products description :
Granulocyte orphan receptor that acts as an trigger efficient phagocytosis of attached particles.
products references :
Molecular cloning of nonspecific cross-reacting antigens in human granulocytes.Kuroki M., Arakawa F., Matsuo Y., Oikawa S., Misumi Y., Nakazato H., Matsuoka Y.J. Biol. Chem. 266:11810-11817(1991) The DNA sequence and biology of human chromosome 19.Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V., Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.Nature 428:529-535(2004)
ncbi gi num :
71143132
ncbi acc num :
NP_001808.2
ncbi gb acc num :
NM_001817.3
uniprot acc num :
O75871
ncbi mol weight :
16.7kD
uniprot summary :
CEACAM4: Belongs to the immunoglobulin superfamily. CEA family. Protein type: Membrane protein, integral. Chromosomal Location of Human Ortholog: 19q13.2. Cellular Component: integral to plasma membrane; membrane. Biological Process: phagocytosis
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.05 mg (Yeast)
price2 :
190
size3 :
0.2 mg (E-Coli)
price3 :
460
size4 :
0.2 mg (Yeast)
price4 :
460
size5 :
0.5 mg (Yeast)
price5 :
750
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!