product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human Fatty acid desaturase 2
catalog :
MBS1090546
quantity :
0.01 mg (E-Coli)
price :
145 USD
more info or order :
product information
catalog number :
MBS1090546
products type :
Recombinant Protein
products full name :
Recombinant Human Fatty acid desaturase 2
products short name :
Fatty acid desaturase 2
products name syn :
Acyl-CoA 6-desaturase; Delta(6) fatty acid desaturase; D6D; Delta(6) desaturase; Delta-6 desaturase
other names :
fatty acid desaturase 2 isoform 2; Fatty acid desaturase 2; fatty acid desaturase 2; fatty acid desaturase 2; Acyl-CoA 6-desaturase; Delta(6) fatty acid desaturase; D6D; Delta(6) desaturase; Delta-6 desaturase
products gene name :
FADS2
other gene names :
FADS2; FADS2; D6D; DES6; TU13; FADSD6; LLCDL2; SLL0262; D6D; Delta(6) desaturase; Delta-6 desaturase
uniprot entry name :
FADS2_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
1-131
sequence length :
422
sequence :
MGKGGNQGEGAAEREVSVPTFSWEEIQKHNLRTDRWLVI
DRKVYNITKWSIQHPGGQRVIGHYAGEDATDAFRAFHPD
LEFVGKFLKPLLIGELAPEEPSQDHGKNSKITEDFRALR
KTAEDMNLFKTNHV
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
other info2 :
Species: Homo sapiens (Human)
products categories :
Cardiovascular
products description :
Component of a lipid metabolic pathway that catalyzes biosynthesis of highly unsaturated fatty acids (HUFA) from precursor essential polyunsaturated fatty acids (PUFA) linoleic acid (LA) (18:2n-6) and alpha-linolenic acid (ALA) (18:3n-3). Catalyzes the first and rate limiting step in this pathway which is the desaturation of LA (18:2n-6) and ALA (18:3n-3) into gamma-linoleic acid (GLA) (18:3n-6) and stearidonic acid (18:4n-3) respectively and other desaturation steps. Highly unsaturated fatty acids (HUFA) play pivotal roles in many biological functions. It catalizes as well the introduction of a cis double bond in palmitate to produce the mono-unsaturated fatty acid sapienate, the most abundant fatty acid in sebum.
products references :
Cloning, expression, and nutritional regulation of the mammalian Delta-6 desaturase." Cho H.P., Nakamura M.T., Clarke S.D. J. Biol. Chem. 274:471-477(1999)
ncbi gi num :
527498295
ncbi acc num :
NP_001268430.1
ncbi gb acc num :
NM_001281501.1
uniprot acc num :
O95864
ncbi mol weight :
48,883 Da
ncbi pathways :
(4Z,7Z,10Z,13Z,16Z)-docosa-4,7,10,13,16-pentaenoate Biosynthesis (6-desaturase) Pathway (1318352); (4Z,7Z,10Z,13Z,16Z)-docosa-4,7,10,13,16-pentaenoate Biosynthesis II (4-desaturase) Pathway (1318353); Biosynthesis Of Unsaturated Fatty Acids Pathway (83034); Biosynthesis Of Unsaturated Fatty Acids Pathway (429); Fatty Acid Metabolism Pathway (868084); Fatty Acid Metabolism Pathway (878045); Linoleic Acid (LA) Metabolism Pathway (1270086); Metabolism Pathway (1269956); Metabolism Of Lipids And Lipoproteins Pathway (1270001); PPAR Signaling Pathway (83042)
ncbi summary :
The protein encoded by this gene is a member of the fatty acid desaturase (FADS) gene family. Desaturase enzymes regulate unsaturation of fatty acids through the introduction of double bonds between defined carbons of the fatty acyl chain. FADS family members are considered fusion products composed of an N-terminal cytochrome b5-like domain and a C-terminal multiple membrane-spanning desaturase portion, both of which are characterized by conserved histidine motifs. This gene is clustered with family members at 11q12-q13.1; this cluster is thought to have arisen evolutionarily from gene duplication based on its similar exon/intron organization. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2013]
uniprot summary :
FADS2: Component of a lipid metabolic pathway that catalyzes biosynthesis of highly unsaturated fatty acids (HUFA) from precursor essential polyunsaturated fatty acids (PUFA) linoleic acid (LA) (18:2n-6) and alpha-linolenic acid (ALA) (18:3n-3). Catalyzes the first and rate limiting step in this pathway which is the desaturation of LA (18:2n-6) and ALA (18:3n-3) into gamma- linoleic acid (GLA) (18:3n-6) and stearidonic acid (18:4n-3) respectively and other desaturation steps. Highly unsaturated fatty acids (HUFA) play pivotal roles in many biological functions. It catalizes as well the introduction of a cis double bond in palmitate to produce the mono-unsaturated fatty acid sapienate, the most abundant fatty acid in sebum. Belongs to the fatty acid desaturase family. 3 isoforms of the human protein are produced by alternative splicing. Protein type: Membrane protein, integral; Membrane protein, multi-pass; EC 1.14.19.-; Lipid Metabolism - alpha-linolenic acid; Oxidoreductase; Lipid Metabolism - unsaturated fatty acid biosynthesis. Chromosomal Location of Human Ortholog: 11q12.2. Cellular Component: endoplasmic reticulum membrane; integral to plasma membrane; membrane. Molecular Function: linoleoyl-CoA desaturase activity; stearoyl-CoA 9-desaturase activity. Biological Process: linoleic acid metabolic process; unsaturated fatty acid biosynthetic process; unsaturated fatty acid metabolic process
size1 :
0.01 mg (E-Coli)
price1 :
145 USD
size2 :
0.05 mg (E-Coli)
price2 :
205
size3 :
0.2 mg (E-Coli)
price3 :
520
size4 :
0.5 mg (E-Coli)
price4 :
850
size5 :
0.05 mg (Baculovirus)
price5 :
870
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!