Recombinant Human Fatty acid desaturase 2 | MyBioSource MBS1090546 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Fatty acid desaturase 2

catalog :

MBS1090546

quantity :

0.01 mg (E-Coli)

price :

145 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS1090546

products type :

Recombinant Protein

products full name :

Recombinant Human Fatty acid desaturase 2

products short name :

Fatty acid desaturase 2

products name syn :

Acyl-CoA 6-desaturase; Delta(6) fatty acid desaturase; D6D; Delta(6) desaturase; Delta-6 desaturase

other names :

fatty acid desaturase 2 isoform 2; Fatty acid desaturase 2; fatty acid desaturase 2; fatty acid desaturase 2; Acyl-CoA 6-desaturase; Delta(6) fatty acid desaturase; D6D; Delta(6) desaturase; Delta-6 desaturase

products gene name :

FADS2

other gene names :

FADS2; FADS2; D6D; DES6; TU13; FADSD6; LLCDL2; SLL0262; D6D; Delta(6) desaturase; Delta-6 desaturase

uniprot entry name :

FADS2_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

1-131

sequence length :

422

sequence :

MGKGGNQGEGAAEREVSVPTFSWEEIQKHNLRTDRWLVI
DRKVYNITKWSIQHPGGQRVIGHYAGEDATDAFRAFHPD
LEFVGKFLKPLLIGELAPEEPSQDHGKNSKITEDFRALR
KTAEDMNLFKTNHV

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

other info2 :

Species: Homo sapiens (Human)

products categories :

Cardiovascular

products description :

Component of a lipid metabolic pathway that catalyzes biosynthesis of highly unsaturated fatty acids (HUFA) from precursor essential polyunsaturated fatty acids (PUFA) linoleic acid (LA) (18:2n-6) and alpha-linolenic acid (ALA) (18:3n-3). Catalyzes the first and rate limiting step in this pathway which is the desaturation of LA (18:2n-6) and ALA (18:3n-3) into gamma-linoleic acid (GLA) (18:3n-6) and stearidonic acid (18:4n-3) respectively and other desaturation steps. Highly unsaturated fatty acids (HUFA) play pivotal roles in many biological functions. It catalizes as well the introduction of a cis double bond in palmitate to produce the mono-unsaturated fatty acid sapienate, the most abundant fatty acid in sebum.

products references :

Cloning, expression, and nutritional regulation of the mammalian Delta-6 desaturase." Cho H.P., Nakamura M.T., Clarke S.D. J. Biol. Chem. 274:471-477(1999)

ncbi gi num :

527498295

ncbi acc num :

NP_001268430.1

ncbi gb acc num :

NM_001281501.1

uniprot acc num :

O95864

ncbi mol weight :

48,883 Da

ncbi pathways :

(4Z,7Z,10Z,13Z,16Z)-docosa-4,7,10,13,16-pentaenoate Biosynthesis (6-desaturase) Pathway (1318352); (4Z,7Z,10Z,13Z,16Z)-docosa-4,7,10,13,16-pentaenoate Biosynthesis II (4-desaturase) Pathway (1318353); Biosynthesis Of Unsaturated Fatty Acids Pathway (83034); Biosynthesis Of Unsaturated Fatty Acids Pathway (429); Fatty Acid Metabolism Pathway (868084); Fatty Acid Metabolism Pathway (878045); Linoleic Acid (LA) Metabolism Pathway (1270086); Metabolism Pathway (1269956); Metabolism Of Lipids And Lipoproteins Pathway (1270001); PPAR Signaling Pathway (83042)

ncbi summary :

The protein encoded by this gene is a member of the fatty acid desaturase (FADS) gene family. Desaturase enzymes regulate unsaturation of fatty acids through the introduction of double bonds between defined carbons of the fatty acyl chain. FADS family members are considered fusion products composed of an N-terminal cytochrome b5-like domain and a C-terminal multiple membrane-spanning desaturase portion, both of which are characterized by conserved histidine motifs. This gene is clustered with family members at 11q12-q13.1; this cluster is thought to have arisen evolutionarily from gene duplication based on its similar exon/intron organization. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2013]

uniprot summary :

FADS2: Component of a lipid metabolic pathway that catalyzes biosynthesis of highly unsaturated fatty acids (HUFA) from precursor essential polyunsaturated fatty acids (PUFA) linoleic acid (LA) (18:2n-6) and alpha-linolenic acid (ALA) (18:3n-3). Catalyzes the first and rate limiting step in this pathway which is the desaturation of LA (18:2n-6) and ALA (18:3n-3) into gamma- linoleic acid (GLA) (18:3n-6) and stearidonic acid (18:4n-3) respectively and other desaturation steps. Highly unsaturated fatty acids (HUFA) play pivotal roles in many biological functions. It catalizes as well the introduction of a cis double bond in palmitate to produce the mono-unsaturated fatty acid sapienate, the most abundant fatty acid in sebum. Belongs to the fatty acid desaturase family. 3 isoforms of the human protein are produced by alternative splicing. Protein type: Membrane protein, integral; Membrane protein, multi-pass; EC 1.14.19.-; Lipid Metabolism - alpha-linolenic acid; Oxidoreductase; Lipid Metabolism - unsaturated fatty acid biosynthesis. Chromosomal Location of Human Ortholog: 11q12.2. Cellular Component: endoplasmic reticulum membrane; integral to plasma membrane; membrane. Molecular Function: linoleoyl-CoA desaturase activity; stearoyl-CoA 9-desaturase activity. Biological Process: linoleic acid metabolic process; unsaturated fatty acid biosynthetic process; unsaturated fatty acid metabolic process

size1 :

0.01 mg (E-Coli)

price1 :

145 USD

size2 :

0.05 mg (E-Coli)

price2 :

205

size3 :

0.2 mg (E-Coli)

price3 :

520

size4 :

0.5 mg (E-Coli)

price4 :

850

size5 :

0.05 mg (Baculovirus)

price5 :

870

more info or order :

MyBioSource product webpage