product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human papillomavirus type 16 Minor capsid protein L2
catalog :
MBS1089949
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
product information
catalog number :
MBS1089949
products type :
Recombinant Protein
products full name :
Recombinant Human papillomavirus type 16 Minor capsid protein L2
products short name :
papillomavirus type 16 Minor capsid protein L2
other names :
minor capsid protein; Minor capsid protein L2; minor capsid protein
products gene name :
L2
other gene names :
L2; L2
uniprot entry name :
VL2_HPV16
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
1-473
sequence length :
473
sequence :
MRHKRSAKRTKRASATQLYKTCKQAGTCPPDIIPKVEGK
TIAEQILQYGSMGVFFGGLGIGTGSGTGGRTGYIPLGTR
PPTATDTLAPVRPPLTVDPVGPSDPSIVSLVEETSFIDA
GAPTSVPSIPPDVSGFSITTSTDTTPAILDINNTVTTVT
THNNPTFTDPSVLQPPTPAETGGHFTLSSSTISTHNYEE
IPMDTFIVSTNPNTVTSSTPIPGSRPVARLGLYSRTTQQ
VKVVDPAFVTTPTKLITYDNP
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Minor protein of the capsid that localizes along the inner surface of the virion, within the central cavities beneath the L1 pentamers. Plays a role in capsid stabilization through interaction with the major capsid protein L1. Once the virion enters the host cell, escorts the genomic DNA into the nucleus, in particular by promoting virion endosomal escape. It is involved, through its interaction with host dynein, in the intracellular microtubule-dependent transport of viral capsid toward the nucleus. Mediates the viral genome import into the nucleus through binding to host importins. Once within the nucleus, L2 localizes viral genomes to PML bodies in order to activate early gene expression for establishment of infection. Later on, promotes late gene expression by interacting with the viral E2 protein and by inhibiting its transcriptional activation functions. During virion assembly, encapsidates the genome by direct interaction with the viral DNA.
products references :
Human papillomavirus type 16 DNA sequence.Seedorf K., Krammer G., Durst M., Suhai S., Rowekamp W.G.Virology 145:181-185(1985) Cloning and sequencing of non-European human papillomavirus (HPV) variant complete genomes from cervicovaginal cells by an overlapping PCR method.Terai M., Fu L., Ma Z., Burk R.D. Interaction of human papillomavirus type 16 L2 with cellular proteins identification of novel nuclear body-associated proteins.Goernemann J., Hofmann T.G., Will H., Mueller M.Virology 303:69-78(2002)Interaction of human papillomavirus (HPV)type 16 capsid proteins with HPV DNA requires an intact L2 N-terminal sequence.Zhou J., Sun X.Y., Louis K., Frazer I.H.J. Virol. 68:619-625(1994) Human papillomavirus type 16 capsid proteins produced from recombinant Semliki Forest virus assemble into virus-like particles.Heino P., Dillner J., Schwartz S.Virology 214:349-359(1995) Nuclear translocation of papillomavirus minor capsid protein L2 requires Hsc70.Florin L., Becker K.A., Sapp C., Lambert C., Sirma H., Muller M., Streeck R.E., Sapp M.J. Virol. 78:5546-5553(2004) The l2 minor capsid protein of human papillomavirus type 16 interacts with a network of nuclear import receptors.Darshan M.S., Lucchi J., Harding E., Moroianu J.J. Virol. 78:12179-12188(2004) Human papillomavirus 16 L2 inhibits the transcriptional activation function, but not the DNA replication function, of HPV-16 E2.Okoye A., Cordano P., Taylor E.R., Morgan I.M., Everett R., Campo M.S.Virus Res. 108:1-14(2005) Expression pattern and subcellular localization of human papillomavirus minor capsid protein L2.Lin Z., Yemelyanova A.V., Gambhira R., Jagu S., Meyers C., Kirnbauer R., Ronnett B.M., Gravitt P.E., Roden R.B.Am. J. Pathol. 174:136-143(2009) Two highly conserved cysteine residues in HPV16 L2 form an intramolecular disulfide bond and are critical for infectivity in human keratinocytes.Campos S.K., Ozbun M.A.PLoS ONE 4:E4463-E4463(2009) Identification of the dynein light chains required for human papillomavirus infection.Schneider M.A., Spoden G.A., Florin L., Lambert C.Cell. Microbiol. 13:32-46(2011)
ncbi gi num :
9627107
ncbi acc num :
NP_041331.1
ncbi gb acc num :
NC_001526.2
uniprot acc num :
P03107
ncbi mol weight :
66.7kD
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.2 mg (E-Coli)
price2 :
460
size3 :
0.5 mg (E-Coli)
price3 :
750
size4 :
1 mg (E-Coli)
price4 :
1180
size5 :
0.05 mg (Baculovirus)
price5 :
1255
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!