Recombinant Human PC4 and SFRS1-interacting protein | MyBioSource MBS1089220 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human PC4 and SFRS1-interacting protein

catalog :

MBS1089220

quantity :

0.05 mg (E-Coli)

price :

180 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS1089220

products type :

Recombinant Protein

products full name :

Recombinant Human PC4 and SFRS1-interacting protein

products short name :

PC4 and SFRS1-interacting

products name syn :

CLL-associated antigen KW-7; Dense fine speckles 70 kDa protein; DFS 70Lens epithelium-derived growth factor; Transcriptional coactivator p75/p52

products gene name :

PSIP1

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

1-530; Full length.

sequence length :

530

sequence :

MTRDFKPGDLIFAKMKGYPHWPARVDEVPDGAVKPPTNK
LPIFFFGTHETAFLGPKDIFPYSENKEKYGKPNKRKGFN
EGLWEIDNNPKVKFSSQQAATKQSNASSDVEVEEKETSV
SKEDTDHEEKASNEDVTKAVDITTPKAARRGRKRKAEKQ
VETEEAGVVTTATASVNLKVSPKRGRPAATEVKIPKPRG
RPKMVKQPCPSESDIITEEDKSKKKGQEEKQPKKQPKKD
EEGQKEEDKPRKEPDKKEGKKEVESKRKNLAKTGVTSTS
DSEEEGDDQEGEKKRKGGRNFQTAHRRNMLKGQHEKEAA
DRKRKQEEQMETEQQNKDEGKKPEVKKVEKKRETSMDSR
LQRIHAEIKNSLKIDNLDVNRCIEALDELASLQVTMQQA
QKHTEMITTLKKIRRFKVSQVIMEKSTMLYNKFKNMFLV
GEGDSVITQVLNKSLAEQRQHEEANKTKDQGKKGPNKKL
EKEQTGSKTLNGGSDAQDGNQPQHNGESNEDSKDNHEAS
TKKKPSSEERETEISLKDSTLDN

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Immunology

products description :

Transcriptional coactivator involved in neuroepithelial st cell differentiation and neurogenesis. Involved in particular in lens epithelial cell gene regulation and stress responses. May play an important role in lens epithelial to fiber cell terminal differentiation. May play a protective role during stress-induced apoptosis. Isoform 2 is a more general and stronger transcriptional coactivator. Isoform 2 may also act as an adapter to coordinate pre-mRNA splicing. Cellular cofactor for lentiviral integration.

products references :

Isolation of cDNAs encoding novel transcription coactivators p52 and p75 reveals an alternate regulatory mechanism of transcriptional activation.Ge H., Si Y., Roeder R.G.EMBO J. 17:6723-6729(1998) Lens epithelium-derived growth factor effects on growth and survival of lens epithelial cells, keratinocytes, and fibroblasts.Singh D.P., Ohguro N., Kikuchi T., Sueno T., Reddy V.N., Yuge K., Chylack L.T. Jr., Shinohara T.Biochem. Biophys. Res. Commun. 267:373-381(2000) Lens epithelium-derived growth factor (LEDGF/p75) and p52 are derived from a single gene by alternative splicing.Singh D.P., Kimura A., Chylack L.T. Jr., Shinohara T.Gene 242:265-273(2000) Identification of tumor-associated antigens in chronic lymphocytic leukemia by SEREX.Krackhardt A.M., Witzens M., Harig S., Hodi F.S., Zauls A.J., Chessia M., Barrett P., Gribben J.G.Blood 100:2123-2131(2002) DNA sequence and analysis of human chromosome 9.Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.Nature 429:369-374(2004)

ncbi acc num :

NP_150091.2

size1 :

0.05 mg (E-Coli)

price1 :

180 USD

size2 :

0.2 mg (E-Coli)

price2 :

490

size3 :

0.2 mg (Yeast)

price3 :

600

size4 :

0.5 mg (E-Coli)

price4 :

715

size5 :

0.05 mg (Baculovirus)

price5 :

905

more info or order :

MyBioSource product webpage