catalog number :
MBS1083983
products type :
Recombinant Protein
products full name :
Recombinant Mouse Carboxylesterase 1C
products short name :
Carboxylesterase 1C
products name syn :
Liver carboxylesterase N; Lung surfactant convertase; PES-N
other names :
carboxylesterase 1C; Carboxylesterase 1C; carboxylesterase 1C; carboxylesterase 1C; Liver carboxylesterase N; Lung surfactant convertase; PES-N
products gene name :
Ces1c
other gene names :
Ces1c; Ces1c; Ee1; Es1; Es4; EsN; Ee-1; Es-4; Es-N; PESN; Ces-N; Es1
uniprot entry name :
EST1C_MOUSE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
19-550, Partial.
sequence :
HSLLPPVVDTTQGKVLGKYISLEGFEQPVAVFLGVPFAK
PPLGSLRFAPPQPAEPWSFVKNATSYPPMCSQDAGWAKI
LSDMFSTEKEILPLKISEDCLYLNIYSPADLTKSSQLPV
MVWIHGGGLVIGGASPYNGLALSAHENVVVVTIQYRLGI
WGLFSTGDEHSPGNWAHLDQLAALRWVQDNIANFGGNPD
SVTIFGESSGGISVSVLVLSPLGKDLFHRAISESGVVIN
TNVGKKNIQAVNEIIATLSQCNDTSSAAMVQCLRQKTES
ELLEISGKLVQYNISLSTMIDGVVLPKAPEEILAEKSFN
TVPYIVGFNKQEFGWIIPMMLQNLLPEGKMNEETASLLL
RRFHSELNISESMIPAVIEQYLRGVDDPAKKSELILDMF
GDIFFGIPAVLLSRSLRDAGVSTYMYEFRYRPSFVSDKR
PQTVEGDHGDEIFFVFGAPLLKEGASEEETNLSKMVMKF
WANFARNGNPNGEGLPHWPEYDEQEGYLQIGATTQQAQR
LKAEEVAFWTELLAKNPPETDPTEH
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs. Involved in the extracellular metabolism of lung surfactant.
products references :
Characterization of a murine cDNA encoding a member of the carboxylesterase multigene family.Ovnic M., Tepperman K., Medda S., Elliott R.W., Stephenson D.A., Grant S.G., Ganschow R.E.Genomics 9:344-354(1991)
Molecular cloning, characterization, and differential expression pattern of mouse lung surfactant convertase.Krishnasamy S., Teng A.L., Dhand R., Schultz R.M., Gross N.J.Am. J. Physiol. 275:L969-L975(1998)
Lineage-specific biology revealed by a finished genome assembly of the mouse.Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S., Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009)
cDNA cloning of esterase 1, the major esterase activity in mouse plasma.Genetta T.L., D'Eustachio P., Kadner S.S., Finlay T.H.Biochem. Biophys. Res. Commun. 151:1364-1370(1988)
Proteome-wide characterization of N-glycosylation events by diagonal chromatography.Ghesquiere B., Van Damme J., Martens L., Vandekerckhove J., Gevaert K.J. Proteome Res. 5:2438-2447(2006)
Enhanced analysis of the mouse plasma proteome using cysteine-containing tryptic glycopeptides.Bernhard O.K., Kapp E.A., Simpson R.J.J. Proteome Res. 6:987-995(2007)
ncbi acc num :
NP_031980.2
ncbi gb acc num :
NM_007954.4
ncbi pathways :
Biological Oxidations Pathway (1324455); Drug Metabolism - Other Enzymes Pathway (83230); Drug Metabolism - Other Enzymes Pathway (428); Metabolic Pathways (132962); Metabolism Pathway (1324226); Phase 1 - Functionalization Of Compounds Pathway (1324456)
uniprot summary :
Es1: Involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs. Involved in the extracellular metabolism of lung surfactant. Belongs to the type-B carboxylesterase/lipase family. Protein type: EC 3.1.1.1. Cellular Component: endoplasmic reticulum; extracellular space. Molecular Function: 1-oxa-2-oxocycloheptane lactonase activity; 3,4-dihydrocoumarin hydrolase activity; all-trans-retinyl-palmitate hydrolase activity; butyrolactone hydrolase activity; hydrolase activity; hydrolase activity, acting on ester bonds; lipase activity; phospholipase activity; prenylcysteine methylesterase activity; retinyl-palmitate esterase activity; sulfolactone hydrolase activity