product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Hepatitis delta virus genotype I Large delta antigen
catalog :
MBS1082755
quantity :
0.01 mg (Baculovirus)
price :
255 USD
more info or order :
MyBioSource product webpage
image
image 1 :
MyBioSource MBS1082755 image 1
product information
catalog number :
MBS1082755
products type :
Recombinant Protein
products full name :
Recombinant Hepatitis delta virus genotype I Large delta antigen
products short name :
[Large delta antigen]
other names :
[Large delta antigen; Large delta antigen; p27]
other gene names :
[L-HDAg; L-HDAg]
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[1-211aa; Full Length of Mature Protein]
sequence :
MSRSESRKNRGGREEILEQWVAGRKKLEELERDLRKTKK
KLKKIEDENPWLGNIKGILGKKDKDGEGAPPAKRARTDQ
MEVDSGPRKRPLRGGFTDKERQDHRRRKALENKKKQLSA
GGKNLSKEEEEELRRLTEEDERRERRVAGPPVGGVIPLE
GGSRGAPGGGFVPSLQGVPESPFSRTGEGLDIRGNRGFP
WDILFPADPPFSPQSC
purity :
>85% (SDS-PAGE)
form :
Liquid containing glycerol
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
image1 heading :
SDS-Page
other info1 :
Species: Hepatitis delta virus genotype I (isolate Italian) (HDV)
other info2 :
Storage Buffer: Tris-based buffer, 50% glycerol. Production Note: Special Offer: The Baculovirus host-expressed protein is manufactured from a stock plasmid containing the protein gene. Baculovirushost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The Baculovirus host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select Baculovirus host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.
ncbi gi num :
226737596
ncbi acc num :
P0C6L6.1
uniprot acc num :
P0C6L6
ncbi mol weight :
24,078 Da
ncbi pathways :
Focal Adhesion Pathway (83067); Focal Adhesion Pathway (478); MAPK Signaling Pathway (83048); MAPK Signaling Pathway (456); Salmonella Infection Pathway (375172); Salmonella Infection Pathway (375149)
uniprot summary :
Following virus entry into host cell, provides nuclear import of HDV RNPs thanks to its nuclear localization signal. Needs co-infection with hepatitis B virus to provide surface proteins, otherwise there is no packaging or budding. Packages the HDV ribonucleoprotein in hepatitis B virus empty particles. Interacts with both HDV genomic RNA and cytoplasmic tail of HBsAg. May inhibit viral RNA replication ().
size1 :
0.01 mg (Baculovirus)
price1 :
255 USD
size2 :
0.02 mg (Baculovirus)
price2 :
395
size3 :
0.05 mg (Baculovirus)
price3 :
755
size4 :
0.1 mg (Baculovirus)
price4 :
1040
size5 :
0.5 mg (Baculovirus)
price5 :
1480
size6 :
1 mg (Baculovirus)
price6 :
2060
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!