catalog number :
MBS1080713
products type :
Recombinant Protein
products full name :
Recombinant Bacillus subtilis Subtilosin-A (sboA)
products short name :
[Subtilosin-A (sboA)]
products name syn :
[Recombinant Subtilosin-A (sboA); Subtilosin-A; Antilisterial bacteriocin subtilosin]
other names :
[subtilosin A; Subtilosin-A; subtilosin A; Antilisterial bacteriocin subtilosin]
products gene name syn :
[sboA; sbo]
other gene names :
[sboA; sboA; sbo]
uniprot entry name :
SBOA_BACSU
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[9-43. Full Length of Mature Protein]
sequence :
NKGCATCSIGAACLVDGPIPDFEIAGATGLFGLWG
form :
Liquid containing glycerol
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
other info1 :
Species: Bacillus subtilis (strain 168)
ncbi acc num :
NP_391616.1
ncbi gb acc num :
NC_000964.3
ncbi mol weight :
4,325 Da
uniprot summary :
Function: Has bacteriocidal activity against some Gram-positive bacteria such as Listeria, some species of Bacillus and E.faecium. Ref.5. Subcellular location: Secreted. Developmental stage: The production of subtilosin A begins at the end of vegetative growth and finishes before spore formation. Induction: Transcription is highly induced by oxygen limitation and is under dual and independent control of Spo0A-AbrB and ResDE. Ref.6. Post-translational modification: This peptide undergoes unique processing steps that include proteolytic cleavage after Glu-8, and covalent linkage of the alpha-amino of Asn-9 with the carboxyl of Gly-43 to form a cyclopeptide. Thioether cross-links are formed between cysteines and the alpha-carbons of other amino acids, Cys-12 to Phe-39, Cys-15 to Thr-36, and Cys-21 to Phe-30. In forming these cross-links, Thr-36 and Phe-39 are converted to D-amino-acids. Sequence similarities: Belongs to the bacteriocin class V family. Caution: Ref.4 sequence does not report residues in positions 30 and 39 probably due to their modification, and reports a cyclic permutation of the peptide sequence. Mass spectrometry: Molecular mass is 3398.9 Da from positions 9 - 43. Determined by FAB. Ref.4
size6 :
0.05 mg (Baculovirus)
size9 :
0.05 mg (Mammalian-Cell)
size10 :
0.1 mg (Baculovirus)
size13 :
0.5 mg (Baculovirus)
size14 :
0.1 mg (Mammalian-Cell)
size16 :
1 mg (Baculovirus)