GLRAQDDYNGWDINTPAFEEYYQSGLSVIMPVGGQSSFY
TDWYQPSQSNGQNYTYKWETFLTREMPAWLQANKGVSPT
GNAAVGLSMSGGSALILAAYYPQQFPYAASLSGFLNPSE
GWWPTLIGLAMNDSGGYNANSMWGPSSDPAWKRNDPMVQ
IPRLVANNTRIWVYCGNGTPSDLGGDNIPAKFLEGLTLR
TNQTFRDTYAADGGRNGVFNFPPNGTHSWPYWNEQLVAM
KADIQHVLNGATPPAAPAAPAA

San Diego, CA 92195-3308
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!
- Recombinant Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast ...
- Recombinant Human Fatty acid desaturase 2 | MBS1090546
- Recombinant Hepatitis B virus genotype C subtype ayw Capsid protein (C)
- Recombinant Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) Outer m ...
- Recombinant Zaire ebolavirus RNA-directed RNA polymerase L (L) ,partial
