Recombinant Human T-box transcription factor TBX18 | MyBioSource MBS1078272 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human T-box transcription factor TBX18

catalog :

MBS1078272

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS1078272

products type :

Recombinant Protein

products full name :

Recombinant Human T-box transcription factor TBX18

products short name :

T-box transcription factor TBX18

other names :

T-box transcription factor TBX18; T-box transcription factor TBX18; T-box transcription factor TBX18; T-box 18

products gene name :

TBX18

other gene names :

TBX18; TBX18; T-box protein 18

uniprot entry name :

TBX18_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

1-607

sequence length :

607

sequence :

MAEKRRGSPCSMLSLKAHAFSVEALIGAEKQQQLQKKRR
KLGAEEAAGAVDDGGCSRGGGAGEKGSSEGDEGAALPPP
AGATSGPARSGADLERGAAGGCEDGFQQGASPLASPGGS
PKGSPARSLARPGTPLPSPQAPRVDLQGAELWKRFHEIG
TEMIITKAGRRMFPAMRVKISGLDPHQQYYIAMDIVPVD
NKRYRYVYHSSKWMVAGNADSPVPPRVYIHPDSPASGET
WMRQVISFDKLKLTNNELDDQ

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Transcription

products description :

Acts as transcriptional repressor involved in developmental processes of a variety of tissues and organs, including the heart and coronary vessels, the ureter and the vertebral column. Required for embryonic development of the sino atrial node (SAN) head area.

products references :

The DNA sequence and analysis of human chromosome 6.Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D., Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.Nature 425:805-811(2003) Identification, mapping and phylogenomic analysis of four new human members of the T-box gene family EOMES, TBX6, TBX18, and TBX19.Yi C.-H., Terrett J.A., Li Q.-Y., Ellington K., Packham E.A., Amstrong-Buisseret L., McClure P., Slingsby T., Brook J.D.Genomics 55:10-20(1999)

ncbi gi num :

122937456

ncbi acc num :

NP_001073977.1

ncbi gb acc num :

NM_001080508.2

uniprot acc num :

O95935

ncbi mol weight :

80.7kD

ncbi summary :

This genes codes for a member of an evolutionarily conserved family of transcription factors that plays a crucial role in embryonic development. The family is characterized by the presence of the DNA-binding T-box domain and is divided into five sub-families based on sequence conservation in this domain. The encoded protein belongs to the vertebrate specific Tbx1 sub-family. The protein acts as a transcriptional repressor by antagonizing transcriptional activators in the T-box family. The protein forms homo- or heterodimers with other transcription factors of the T-box family or other transcription factors. [provided by RefSeq, Nov 2012]

uniprot summary :

TBX18: Probable transcriptional regulator involved in developmental processes. Protein type: Transcription factor; DNA-binding. Chromosomal Location of Human Ortholog: 6q14-q15. Cellular Component: nucleus. Molecular Function: protein binding; protein heterodimerization activity; protein homodimerization activity; transcription factor activity. Biological Process: anterior/posterior axis specification; morphogenesis of embryonic epithelium; negative regulation of transcription from RNA polymerase II promoter; positive regulation of cell-cell adhesion; positive regulation of epithelial cell proliferation; sensory perception of sound; smooth muscle cell differentiation; somitogenesis; transcription, DNA-dependent. Disease: Huntington Disease

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.2 mg (E-Coli)

price2 :

460

size3 :

0.5 mg (E-Coli)

price3 :

750

size4 :

1 mg (E-Coli)

price4 :

1180

size5 :

0.05 mg (Baculovirus)

price5 :

1400

more info or order :

MyBioSource product webpage