catalog number :
MBS1078212
products type :
Recombinant Protein
products full name :
Recombinant Rat Transient receptor potential cation channel subfamily V member 1 (Trpv1)
products short name :
Transient receptor potential cation channel subfamily V member 1 (Trpv1)
products name syn :
Recombinant Transient receptor potential cation channel subfamily V member 1 (Trpv1); Transient receptor potential cation channel subfamily V member 1; TrpV1; Capsaicin receptor Osm-9-like TRP channel 1; OTRPC1 Vanilloid receptor 1 Vanilloid receptor type
other names :
transient receptor potential cation channel subfamily V member 1; Transient receptor potential cation channel subfamily V member 1; transient receptor potential cation channel subfamily V member 1; OTRPC1; capsaicin receptor; vanilloid receptor 1; osm-9-like TRP channel 1; vanilloid type 1 receptor; vanilloid receptor subtype 1; vanilloid receptor type 1 like protein 1; transient receptor potential cation channel, subfamily V, member 1; Capsaicin receptor; Osm-9-like TRP channel 1; OTRPC1; Vanilloid receptor 1; Vanilloid receptor type 1-like
products gene name syn :
Trpv1; Vr1, Vr1l
other gene names :
Trpv1; Trpv1; Vr1; Vr1l1; VR.5'sv; Vr1; Vr1l; TrpV1; OTRPC1
uniprot entry name :
TRPV1_RAT
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence :
MEQRASLDSEESESPPQENSCLDPPDRDPNCKPPPVKPH
IFTTRSRTRLFGKGDSEEASPLDCPYEEGGLASCPIITV
SSVLTIQRPGDGPASVRPSSQDSVSAGEKPPRLYDRRSI
FDAVAQSNCQELESLLPFLQRSKKRLTDSEFKDPETGKT
CLLKAMLNLHNGQNDTIALLLDVARKTDSLKQFVNASYT
DSYYKGQTALHIAIERRNMTLVTLLVENGADVQAAANGD
FFKKTKGRPGFYFGELPLSLAACTNQLAIVKFLLQNSWQ
PADISARDSVGNTVLHALVEVADNTVDNTKFVTSMYNEI
LILGAKLHPTLKLEEITNRKGLTPLALAASSGKIGVLAY
ILQREIHEPECRHLSRKFTEWAYGPVHSSLYDLSCIDTC
EKNSVLEVIAYSSSETPNRHDMLLVEPLNRLLQDKWDRF
VKR
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
other info1 :
Species: Rattus norvegicus (Rat)
ncbi acc num :
NP_114188.1
ncbi gb acc num :
NM_031982.1
ncbi mol weight :
94,948 Da
ncbi pathways :
Neuroactive Ligand-receptor Interaction Pathway (83445); Neuroactive Ligand-receptor Interaction Pathway (462)
ncbi summary :
ion channel that demonstrates heat-evoked membrane currents [RGD, Feb 2006]
uniprot summary :
TRPV1: a receptor for capsaicin and a non-selective cation channel that is structurally related to members of the TRP family of ion channels. Activated by increases in temperature in the noxious range, suggesting that it functions as a transducer of painful thermal stimuli in vivo. Protein type: Membrane protein, integral; Membrane protein, multi-pass; Channel, cation; Receptor, misc. Cellular Component: postsynaptic membrane; neuron projection; cell soma; membrane; dendrite; plasma membrane; integral to membrane; synapse; cytosol; cell junction; intrinsic to plasma membrane; external side of plasma membrane. Molecular Function: identical protein binding; excitatory extracellular ligand-gated ion channel activity; calcium channel activity; ion channel activity; phosphoprotein binding; ligand-gated ion channel activity; calmodulin binding; protein binding; transmembrane receptor activity; chloride channel regulator activity; cation transmembrane transporter activity; calcium-release channel activity; cation channel activity; ATP binding. Biological Process: urinary bladder smooth muscle contraction; response to peptide hormone stimulus; diet induced thermogenesis; positive regulation of nitric oxide biosynthetic process; positive regulation of apoptosis; microglial cell activation; response to pain; thermoception; thermoregulation; sensory perception of mechanical stimulus; fever; sensory perception of pain; signal transduction; behavioral response to pain; elevation of cytosolic calcium ion concentration; calcium ion transport; inflammatory response; peptide secretion; detection of chemical stimulus involved in sensory perception of pain; response to organic nitrogen; glutamate secretion; response to heat; smooth muscle contraction involved in micturition; lipid metabolic process; response to pH
size3 :
0.05 mg (Mammalian-Cell)