catalog number :
MBS1077102
products type :
Recombinant Protein
products full name :
Recombinant Mouse Beclin-1 (Becn1)
products short name :
[Beclin-1 (Becn1)]
products name syn :
[Beclin-1; Coiled-coil myosin-like BCL2-interacting protein]
other names :
[beclin-1; Beclin-1; beclin-1; Bcl-2-interacting protein beclin; coiled-coil myosin-like BCL2-interacting protein; coiled-coil, myosin-like BCL2-interacting protein; beclin 1, autophagy related; Coiled-coil myosin-like BCL2-interacting protein]
products gene name :
[Becn1]
other gene names :
[Becn1; Becn1; Atg6; 4921513J16Rik; 5430417M23Rik]
uniprot entry name :
BECN1_MOUSE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[1-448. Full Length]
sequence :
MEGSKASSSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQ
ELTAPLLTTAQAKPGETQEEEANSGEEPFIETRQDGVSR
RFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVT
GDLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENE
CQNYKRCLEILEQMNEDDSEQLQRELKELALEEERLIQE
LEDVEKNRKVVAENLEKVQAEAERLDQEEAQYQREYSEF
KRQQLELDDELKSVENQVRYAQIQLDKLKKTNVFNATFH
IWHSGQFGTINNFRLGRLPSVPVEWNEINAAWGQTVLLL
HALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELPLYC
SGGLRFFWDNKFDHAMVAFLDCVQQFKEEVEKGETRFCL
PYRMDVEKGKIEDTGGSGGSYSIKTQFNSEEQWTKALKF
MLTNLKWGLAWVSSQFYNK
form :
Liquid containing glycerol
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
image1 heading :
SDS-PAGE
other info1 :
Species: Mus musculus (Mouse)
products categories :
Epigenetics and Nuclear Signaling
products description :
Plays a central role in autophagy (PubMed:10604474, PubMed:12372286, PubMed:19270693). Acts as core subunit of different PI3K complex forms that mediate formation of phosphatidylinositol 3-phosphate and are believed to play a role in multiple membrane trafficking pathways: PI3KC3-C1 is involved in initiation of autophagosomes and PI3KC3-C2 in maturation of autophagosomes and endocytosis (PubMed:19270693, PubMed:25275521). Involved in regulation of degradative endocytic trafficking and required for the abcission step in cytokinesis, probably in the context of PI3KC3-C2 (By similarity). Essential for the formation of PI3KC3-C2 but not PI3KC3-C1 PI3K complex forms (PubMed:25275521). Involved in endocytosis including endosome formation in neuronal cells (PubMed:25275521). May play a role in antiviral host defense (By similarity).
ncbi acc num :
NP_062530.2
ncbi gb acc num :
NM_019584.3
ncbi mol weight :
51,589 Da
ncbi pathways :
Regulation Of Autophagy Pathway (83255); Regulation Of Autophagy Pathway (468); Senescence And Autophagy Pathway (198361)
uniprot summary :
beclin 1: an essential autophagy protein that has been linked to multiple processes including tumor suppression, protection against some cardiac and neurological degenerative diseases, and lifespan extension. A ubiquitous protein of the beclin family. Is part of the class III PI3K complex that induces autophagy. Expressed at elevated levels in dendrites and cell bodies of cerebellar Purkinje cells. Interacts with the anti-apoptotic protein Bcl-2, which inhibits autophagy when it is present in the endoplasmic reticulum. The dissociation of ATG6 from Bcl-2 is essential for its autophagic activity. Interacts with PITC and GluR-delta2. Probably forms a complex with AMBRA1 and PIK3C3. Plays a role in antiviral host defense. Protects against infection by a neurovirulent strain of Sindbis virus. Protein type: Adaptor/scaffold; Autophagy; Membrane protein, peripheral. Cellular Component: Golgi apparatus; protein complex; extrinsic to membrane; cytoskeleton; mitochondrion; membrane; endoplasmic reticulum; cytoplasmic membrane-bound vesicle; dendrite; cytoplasm; trans-Golgi network; phagocytic vesicle; nucleus; endosome. Molecular Function: protein binding; phosphoinositide 3-kinase binding. Biological Process: late endosome to vacuole transport; cytokinesis; response to other organism; cell cycle; CVT pathway; cellular response to nitrogen starvation; negative regulation of cell proliferation; cell division; regulation of catalytic activity; lysosome organization and biogenesis; beta-amyloid metabolic process; mitochondrion degradation; neuron development; autophagy; angiogenesis; defense response to virus; positive regulation of macroautophagy; positive regulation of autophagy; negative regulation of apoptosis; autophagic vacuole formation
size7 :
0.05 mg (Baculovirus)
size9 :
0.05 mg (Mammalian-Cell)
size11 :
0.1 mg (Baculovirus)
size13 :
0.5 mg (Baculovirus)
size14 :
0.1 mg (Mammalian-Cell)
size16 :
1 mg (Baculovirus)