protein

Recombinant Human Elongation factor 1-alpha 1

MBS1075765

0.05 mg (E-Coli)

190 USD

Recombinant Protein

Recombinant Human Elongation factor 1-alpha 1

Elongation factor 1-alpha 1

Elongation factor Tu; EF-Tu; Eukaryotic elongation factor 1 A-1; e; EF1A-1; Leukocyte receptor cluster member 7

elongation factor 1-alpha 1; Elongation factor 1-alpha 1; elongation factor 1-alpha 1; eukaryotic translation elongation factor 1 alpha 1; Elongation factor Tu; EF-Tu; Eukaryotic elongation factor 1 A-1; eEF1A-1; Leukocyte receptor cluster member 7

EEF1A1

EEF1A1; EEF1A1; CCS3; EF1A; PTI1; CCS-3; EE1A1; EEF-1; EEF1A; EF-Tu; LENG7; eEF1A-1; GRAF-1EF; HNGC:16303; EEF1A; EF1A; LENG7; EF-1-alpha-1; EF-Tu; eEF1A-1

EF1A1_HUMAN

E Coli or Yeast or Baculovirus or Mammalian Cell

50-462

462

GKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVT
IIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGI
SKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKR
YEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPS
ANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDK
PLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPV
NVTTEVKSVEMHHEALSEALP

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Epigenetics and Nuclear Signaling

This protein promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis. With PARP1 and TXK, forms a complex that acts as a T helper 1 (Th1) cell-specific transcription factor and binds the promoter of IFN-gamma to directly regulate its transcription, and is thus involved importantly in Th1 cytokine production.

The primary structure of the alpha subunit of human elongation factor 1. Structural aspects of guanine-nucleotide-binding sites.Brands J.H.G.M., Maassen J.A., van Hemert F.J., Amons R., Moeller W.Eur. J. Biochem. 155:167-171(1986) Isolation and characterization of the human chromosomal gene for polypeptide chain elongation factor-1 alpha.Uetsuki T., Naito A., Nagata S., Kaziro Y.J. Biol. Chem. 264:5791-5798(1989) Retropseudogenes constitute the major part of the human elongation factor 1 alpha gene family.Madsen H.O., Poulsen K., Dahl O., Clark B.F.C., Hjorth J.P.Nucleic Acids Res. 18:1513-1516(1990) Postnatal expression of a novel mRNA isoform from the human elongation factor-1a gene.Shimazu T., Koike K. Structure of the amino-terminal end of mammalian elongation factor Tu.Rao T.R., Slobin L.I.Nucleic Acids Res. 14:2409-2409(1986) Bienvenut W.V., Zebisch A., Kolch W.Submitted (JAN-2010) to UniProtKB Txk, a member of the non-receptor tyrosine kinase of the Tec family, forms a complex with poly(ADP-ribose) polymerase 1 and elongation factor 1alpha and regulates interferon-gamma gene transcription in Th1 cells.Maruyama T., Nara K., Yoshikawa H., Suzuki N.Clin. Exp. Immunol. 147:164-175(2007) Bienvenut W.V.Submitted (JUN-2005) to UniProtKB Retinol-regulated gene expression in human tracheobronchial epithelial cells. Enhanced expression of elongation factor EF-1 alpha.Ann D.K., Wu M.M.J., Huang T., Carlson D.M., Wu R.J. Biol. Chem. 263:3546-3549(1988) Murine elongation factor 1 alpha (EF-1 alpha) is posttranslationally modified by novel amide-linked ethanolamine-phosphoglycerol moieties. Addition of ethanolamine-phosphoglycerol to specific glutamic acid residues on EF-1 alpha.Whiteheart S.W., Shenbagarmurthi P., Chen L., Cotter R.J., Hart G.W.J. Biol. Chem. 264:14334-14341(1989) Binding of zinc finger protein ZPR1 to the epidermal growth factor receptor.Galcheva-Gargova Z., Konstantinov K.N., Wu I.-H., Klier F.G., Barrett T., Davis R.J.Science 272:1797-1802(1996) Induction of acute translational response genes by homocysteine. Elongation factors-1alpha, -beta, and -delta.Chacko G., Ling Q., Hajjar K.A.J. Biol. Chem. 273:19840-19846(1998) Exp5 exports eEF1A via tRNA from nuclei and synergizes with other transport pathways to confine translation to the cytoplasm.Bohnsack M.T., Regener K., Schwappach B., Saffrich R., Paraskeva E., Hartmann E., Goerlich D.EMBO J. 21:6205-6215(2002) Exportin-5-mediated nuclear export of eukaryotic elongation factor 1A and tRNA.Calado A., Treichel N., Mueller E.-C., Otto A., Kutay U.EMBO J. 21:6216-6224(2002) Proteomic identification of proteins conjugated to ISG15 in mouse and human cells.Giannakopoulos N.V., Luo J.K., Papov V., Zou W., Lenschow D.J., Jacobs B.S., Borden E.C., Li J., Virgin H.W., Zhang D.E.Biochem. Biophys. Res. Commun. 336:496-506(2005) Male germ cell expression of the PAS domain kinase PASKIN and its novel target eukaryotic translation elongation factor eEF1A1.Eckhardt K., Troger J., Reissmann J., Katschinski D.M., Wagner K.F., Stengel P., Paasch U., Hunziker P., Borter E., Barth S., Schlafli P., Spielmann P., Stiehl D.P., Camenisch G., Wenger R.H.Cell. Physiol. Biochem. 20:227-240(2007) Lysyl-tRNA synthetase interacts with EF1alpha, aspartyl-tRNA synthetase and p38 in vitro.Guzzo C.M., Yang D.C.H.Biochem. Biophys. Res. Commun. 365:718-723(2008) The possible interaction of CDA14 and protein elongation factor 1alpha.Yang Y.F., Chou M.Y., Fan C.Y., Chen S.F., Lyu P.C., Liu C.C., Tseng T.L.Biochim. Biophys. Acta 1784:312-318(2008) The SAM domain of the RhoGAP DLC1 binds EF1A1 to regulate cell migration.Zhong D., Zhang J., Yang S., Soh U.J., Buschdorf J.P., Zhou Y.T., Yang D., Low B.C.J. Cell Sci. 122:414-424(2009) Phosphorylation of eEF1A1 at Ser300 by TbetaR-I results in inhibition of mRNA translation.Lin K.W., Yakymovych I., Jia M., Yakymovych M., Souchelnytskyi S.Curr. Biol. 20:1615-1625(2010)

4503471

NP_001393.1

NM_001402.5

P68104

46.7kD

Cellular Response To Heat Stress Pathway (1270421); Cellular Responses To Stress Pathway (1270414); EGFR1 Signaling Pathway (198782); Eukaryotic Translation Elongation Pathway (1268690); Gene Expression Pathway (1269649); HSF1 Activation Pathway (1270422); Legionellosis Pathway (469200); Legionellosis Pathway (469186); Metabolism Of Proteins Pathway (1268677); Peptide Chain Elongation Pathway (1268691)

This gene encodes an isoform of the alpha subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This isoform (alpha 1) is expressed in brain, placenta, lung, liver, kidney, and pancreas, and the other isoform (alpha 2) is expressed in brain, heart and skeletal muscle. This isoform is identified as an autoantigen in 66% of patients with Felty syndrome. This gene has been found to have multiple copies on many chromosomes, some of which, if not all, represent different pseudogenes. [provided by RefSeq, Jul 2008]

EEF1A1: an isoform of the alpha subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This isoform (alpha 1) is expressed in brain, placenta, lung, liver, kidney, and pancreas. Promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis. Protein type: Translation; Translation elongation; Nucleolus. Chromosomal Location of Human Ortholog: 6q14.1. Cellular Component: cortical actin cytoskeleton; cytoplasm; cytosol; eukaryotic translation elongation factor 1 complex; extracellular space; membrane; nucleolus; nucleus. Molecular Function: GTP binding; GTPase activity; protein binding; protein kinase binding; translation elongation factor activity; tRNA binding. Biological Process: cellular protein metabolic process; gene expression; regulation of transcription, DNA-dependent; transcription, DNA-dependent; translation; translational elongation

0.05 mg (E-Coli)

190 USD

0.2 mg (E-Coli)

460

0.5 mg (E-Coli)

750

1 mg (E-Coli)

1180

0.05 mg (Baculovirus)

1245