product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human Elongation factor 1-alpha 1
catalog :
MBS1075765
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
product information
catalog number :
MBS1075765
products type :
Recombinant Protein
products full name :
Recombinant Human Elongation factor 1-alpha 1
products short name :
Elongation factor 1-alpha 1
products name syn :
Elongation factor Tu; EF-Tu; Eukaryotic elongation factor 1 A-1; e; EF1A-1; Leukocyte receptor cluster member 7
other names :
elongation factor 1-alpha 1; Elongation factor 1-alpha 1; elongation factor 1-alpha 1; eukaryotic translation elongation factor 1 alpha 1; Elongation factor Tu; EF-Tu; Eukaryotic elongation factor 1 A-1; eEF1A-1; Leukocyte receptor cluster member 7
products gene name :
EEF1A1
other gene names :
EEF1A1; EEF1A1; CCS3; EF1A; PTI1; CCS-3; EE1A1; EEF-1; EEF1A; EF-Tu; LENG7; eEF1A-1; GRAF-1EF; HNGC:16303; EEF1A; EF1A; LENG7; EF-1-alpha-1; EF-Tu; eEF1A-1
uniprot entry name :
EF1A1_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
50-462
sequence length :
462
sequence :
GKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVT
IIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGI
SKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKR
YEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPS
ANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDK
PLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPV
NVTTEVKSVEMHHEALSEALP
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products categories :
Epigenetics and Nuclear Signaling
products description :
This protein promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis. With PARP1 and TXK, forms a complex that acts as a T helper 1 (Th1) cell-specific transcription factor and binds the promoter of IFN-gamma to directly regulate its transcription, and is thus involved importantly in Th1 cytokine production.
products references :
The primary structure of the alpha subunit of human elongation factor 1. Structural aspects of guanine-nucleotide-binding sites.Brands J.H.G.M., Maassen J.A., van Hemert F.J., Amons R., Moeller W.Eur. J. Biochem. 155:167-171(1986) Isolation and characterization of the human chromosomal gene for polypeptide chain elongation factor-1 alpha.Uetsuki T., Naito A., Nagata S., Kaziro Y.J. Biol. Chem. 264:5791-5798(1989) Retropseudogenes constitute the major part of the human elongation factor 1 alpha gene family.Madsen H.O., Poulsen K., Dahl O., Clark B.F.C., Hjorth J.P.Nucleic Acids Res. 18:1513-1516(1990) Postnatal expression of a novel mRNA isoform from the human elongation factor-1a gene.Shimazu T., Koike K. Structure of the amino-terminal end of mammalian elongation factor Tu.Rao T.R., Slobin L.I.Nucleic Acids Res. 14:2409-2409(1986) Bienvenut W.V., Zebisch A., Kolch W.Submitted (JAN-2010) to UniProtKB Txk, a member of the non-receptor tyrosine kinase of the Tec family, forms a complex with poly(ADP-ribose) polymerase 1 and elongation factor 1alpha and regulates interferon-gamma gene transcription in Th1 cells.Maruyama T., Nara K., Yoshikawa H., Suzuki N.Clin. Exp. Immunol. 147:164-175(2007) Bienvenut W.V.Submitted (JUN-2005) to UniProtKB Retinol-regulated gene expression in human tracheobronchial epithelial cells. Enhanced expression of elongation factor EF-1 alpha.Ann D.K., Wu M.M.J., Huang T., Carlson D.M., Wu R.J. Biol. Chem. 263:3546-3549(1988) Murine elongation factor 1 alpha (EF-1 alpha) is posttranslationally modified by novel amide-linked ethanolamine-phosphoglycerol moieties. Addition of ethanolamine-phosphoglycerol to specific glutamic acid residues on EF-1 alpha.Whiteheart S.W., Shenbagarmurthi P., Chen L., Cotter R.J., Hart G.W.J. Biol. Chem. 264:14334-14341(1989) Binding of zinc finger protein ZPR1 to the epidermal growth factor receptor.Galcheva-Gargova Z., Konstantinov K.N., Wu I.-H., Klier F.G., Barrett T., Davis R.J.Science 272:1797-1802(1996) Induction of acute translational response genes by homocysteine. Elongation factors-1alpha, -beta, and -delta.Chacko G., Ling Q., Hajjar K.A.J. Biol. Chem. 273:19840-19846(1998) Exp5 exports eEF1A via tRNA from nuclei and synergizes with other transport pathways to confine translation to the cytoplasm.Bohnsack M.T., Regener K., Schwappach B., Saffrich R., Paraskeva E., Hartmann E., Goerlich D.EMBO J. 21:6205-6215(2002) Exportin-5-mediated nuclear export of eukaryotic elongation factor 1A and tRNA.Calado A., Treichel N., Mueller E.-C., Otto A., Kutay U.EMBO J. 21:6216-6224(2002) Proteomic identification of proteins conjugated to ISG15 in mouse and human cells.Giannakopoulos N.V., Luo J.K., Papov V., Zou W., Lenschow D.J., Jacobs B.S., Borden E.C., Li J., Virgin H.W., Zhang D.E.Biochem. Biophys. Res. Commun. 336:496-506(2005) Male germ cell expression of the PAS domain kinase PASKIN and its novel target eukaryotic translation elongation factor eEF1A1.Eckhardt K., Troger J., Reissmann J., Katschinski D.M., Wagner K.F., Stengel P., Paasch U., Hunziker P., Borter E., Barth S., Schlafli P., Spielmann P., Stiehl D.P., Camenisch G., Wenger R.H.Cell. Physiol. Biochem. 20:227-240(2007) Lysyl-tRNA synthetase interacts with EF1alpha, aspartyl-tRNA synthetase and p38 in vitro.Guzzo C.M., Yang D.C.H.Biochem. Biophys. Res. Commun. 365:718-723(2008) The possible interaction of CDA14 and protein elongation factor 1alpha.Yang Y.F., Chou M.Y., Fan C.Y., Chen S.F., Lyu P.C., Liu C.C., Tseng T.L.Biochim. Biophys. Acta 1784:312-318(2008) The SAM domain of the RhoGAP DLC1 binds EF1A1 to regulate cell migration.Zhong D., Zhang J., Yang S., Soh U.J., Buschdorf J.P., Zhou Y.T., Yang D., Low B.C.J. Cell Sci. 122:414-424(2009) Phosphorylation of eEF1A1 at Ser300 by TbetaR-I results in inhibition of mRNA translation.Lin K.W., Yakymovych I., Jia M., Yakymovych M., Souchelnytskyi S.Curr. Biol. 20:1615-1625(2010)
ncbi gi num :
4503471
ncbi acc num :
NP_001393.1
ncbi gb acc num :
NM_001402.5
uniprot acc num :
P68104
ncbi mol weight :
46.7kD
ncbi pathways :
Cellular Response To Heat Stress Pathway (1270421); Cellular Responses To Stress Pathway (1270414); EGFR1 Signaling Pathway (198782); Eukaryotic Translation Elongation Pathway (1268690); Gene Expression Pathway (1269649); HSF1 Activation Pathway (1270422); Legionellosis Pathway (469200); Legionellosis Pathway (469186); Metabolism Of Proteins Pathway (1268677); Peptide Chain Elongation Pathway (1268691)
ncbi summary :
This gene encodes an isoform of the alpha subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This isoform (alpha 1) is expressed in brain, placenta, lung, liver, kidney, and pancreas, and the other isoform (alpha 2) is expressed in brain, heart and skeletal muscle. This isoform is identified as an autoantigen in 66% of patients with Felty syndrome. This gene has been found to have multiple copies on many chromosomes, some of which, if not all, represent different pseudogenes. [provided by RefSeq, Jul 2008]
uniprot summary :
EEF1A1: an isoform of the alpha subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This isoform (alpha 1) is expressed in brain, placenta, lung, liver, kidney, and pancreas. Promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis. Protein type: Translation; Translation elongation; Nucleolus. Chromosomal Location of Human Ortholog: 6q14.1. Cellular Component: cortical actin cytoskeleton; cytoplasm; cytosol; eukaryotic translation elongation factor 1 complex; extracellular space; membrane; nucleolus; nucleus. Molecular Function: GTP binding; GTPase activity; protein binding; protein kinase binding; translation elongation factor activity; tRNA binding. Biological Process: cellular protein metabolic process; gene expression; regulation of transcription, DNA-dependent; transcription, DNA-dependent; translation; translational elongation
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.2 mg (E-Coli)
price2 :
460
size3 :
0.5 mg (E-Coli)
price3 :
750
size4 :
1 mg (E-Coli)
price4 :
1180
size5 :
0.05 mg (Baculovirus)
price5 :
1245
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!