Recombinant Human Agouti-related protein | MyBioSource MBS1075471 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Agouti-related protein

catalog :

MBS1075471

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS1075471

products type :

Recombinant Protein

products full name :

Recombinant Human Agouti-related protein

products short name :

Agouti-related protein

other names :

Agouti-related protein; agouti-related protein; agouti related neuropeptide

products gene name :

AGRP

other gene names :

AGRP; AGRP; ART; AGRT; ASIP2; AGRT; ART

uniprot entry name :

AGRP_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

21-132

sequence length :

132

sequence :

AQMGLAPMEGIRRPDQALLPELPGLGLRAPLKKTTAEQA
EEDLLQEAQALAEVLDLQDREPRSSRRCVRLHESCLGQQ
VPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Cardiovascular

products description :

Plays a role in weight homeostasis. Involved in the control of feeding behavior through the central melanocortin system. Acts as alpha melanocyte-stimulating hormone antagonist by inhibiting cAMP production mediated by stimulation of melanocortin receptors within the hypothalamus and adrenal gland. Has very low activity with MC5R. Is an inverse agonist for MC3R and MC4R being able to suppress their constitutive activity. It promotes MC3R and MC4R endocytosis in an arrestin-dependent manner.

products references :

Hypothalamic expression of ART, a novel gene related to agouti, is up-regulated in obese and diabetic mutant mice.Shutter J.R., Graham M., Kinsey A.C., Scully S., Luethy R., Stark K.L.Genes Dev. 11:593-602(1997) Antagonism of central melanocortin receptors in vitro and in vivo by agouti-related protein.Ollmann M.M., Wilson B.D., Yang Y.K., Kerns J.A., Chen Y., Gantz I., Barsh G.S.Science 278:135-138(1997) The gene structure and minimal promoter of the human agouti related protein.Brown A.M., Mayfield D.K., Volaufova J., Argyropoulos G.Gene 277:231-238(2001) Association between an agouti-related protein gene polymorphism and anorexia nervosa.Vink T., Hinney A., van Elburg A.A., van Goozen S.H., Sandkuijl L.A., Sinke R.J., Herpertz-Dahlmann B.M., Hebebrand J., Remschmidt H., van Engeland H., Adan R.A.Mol. Psychiatry 6:325-328(2001) SeattleSNPs variation discovery resource Determination of disulfide structure in agouti-related protein (AGRP) by stepwise reduction and alkylation.Bures E.J., Hui J.O., Young Y., Chow D.T., Katta V., Rohde M.F., Zeni L., Rosenfeld R.D., Stark K.L., Haniu M.Biochemistry 37:12172-12177(1998) Characterization of Agouti-related protein binding to melanocortin receptors.Yang Y.K., Thompson D.A., Dickinson C.J., Wilken J., Barsh G.S., Kent S.B., Gantz I.Mol. Endocrinol. 13:148-155(1999) AgRP(83-132) acts as an inverse agonist on the human-melanocortin-4 receptor.Nijenhuis W.A., Oosterom J., Adan R.A.Mol. Endocrinol. 15:164-171(2001) The natural inverse agonist agouti-related protein induces arrestin-mediated endocytosis of melanocortin-3 and -4 receptors.Breit A., Wolff K., Kalwa H., Jarry H., Buch T., Gudermann T.J. Biol. Chem. 281:37447-37456(2006) NMR structure of a minimized human agouti related protein prepared by total chemical synthesis.Bolin K.A., Anderson D.J., Trulson J.A., Thompson D.A., Wilken J., Kent S.B.H., Gantz I., Millhauser G.L.FEBS Lett. 451:125-131(1999) High-resolution NMR structure of the chemically-synthesized melanocortin receptor binding domain AGRP(87-132) of the agouti-related protein.McNulty J.C., Thompson D.A., Bolin K.A., Wilken J., Barsh G.S., Millhauser G.L.Biochemistry 40:15520-15527(2001) Design, pharmacology, and NMR structure of a minimized cystine knot with agouti-related protein activity.Jackson P.J., McNulty J.C., Yang Y.K., Thompson D.A., Chai B., Gantz I., Barsh G.S., Millhauser G.L.Biochemistry 41:7565-7572(2002) A polymorphism in the human agouti-related protein is associated with late-onset obesity.Argyropoulos G., Rankinen T., Neufeld D.R., Rice T., Province M.A., Leon A.S., Skinner J.S., Wilmore J.H., Rao D.C., Bouchard C.J. Clin. Endocrinol. Metab. 87:4198-4202(2002) Functional analysis of the Ala67Thr polymorphism in agouti related protein associated with anorexia nervosa and leanness.de Rijke C.E., Jackson P.J., Garner K.M., van Rozen R.J., Douglas N.R., Kas M.J., Millhauser G.L., Adan R.A.Biochem. Pharmacol. 70:308-316(2005)

ncbi acc num :

NP_001129.1

uniprot acc num :

O00253

ncbi mol weight :

28.5kD

ncbi pathways :

Adipocytokine Signaling Pathway (83093); Adipocytokine Signaling Pathway (505); Syndecan-3-mediated Signaling Events Pathway (137952)

ncbi summary :

This gene encodes an antagonist of the melanocortin-3 and melanocortin-4 receptor. It appears to regulate hypothalamic control of feeding behavior via melanocortin receptor and/or intracellular calcium regulation, and thus plays a role in weight homeostasis. Mutations in this gene have been associated with late on-set obesity. [provided by RefSeq, Dec 2009]

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.2 mg (E-Coli)

price2 :

460

size3 :

0.5 mg (E-Coli)

price3 :

750

size4 :

0.05 mg (Baculovirus)

price4 :

845

size5 :

0.05 mg (Mammalian-Cell)

price5 :

1070

more info or order :

MyBioSource product webpage