product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Saccharomyces cerevisiae A-agglutinin-binding subunit
catalog :
MBS1074393
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1074393
products type :
Recombinant Protein
products full name :
Recombinant Saccharomyces cerevisiae A-agglutinin-binding subunit
products short name :
A-agglutinin-binding subunit
other names :
Aga2p; A-agglutinin-binding subunit; Aga2p
products gene name :
AGA2
other gene names :
AGA2; AGA2
uniprot entry name :
AGA2_YEAST
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
19-87
sequence length :
87
sequence :
QELTTICEQIPSPTLESTPYSLSTTTILANGKAMQGVFE
YYKSVTFVSNCGSHPSTTSKGSPINTQYVF
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Receptor binding subunit of the a-agglutinin heterodimer. S. cerevisiae a and alpha cells express the complentary cell surface glycoproteins a-agglutinin and alpha-agglutinin, respectively, which interact with one another to promote cellular aggregation during mating.
products references :
Saccharomyces cerevisiae a- and alpha-agglutinin characterization of their molecular interaction.Cappellaro C., Hauser K., Mrsa V., Watzele M., Watzele G., Gruber C., Tanner W.EMBO J. 10:4081-4088(1991) The nucleotide sequence of Saccharomyces cerevisiae chromosome VII.Tettelin H., Agostoni-Carbone M.L., Albermann K., Albers M., Arroyo J., Backes U., Barreiros T., Bertani I., Bjourson A.J., Brueckner M., Bruschi C.V., Carignani G., Castagnoli L., Cerdan E., Clemente M.L., Coblenz A., Coglievina M., Coissac E., Defoor E., Del Bino S., Delius H., Delneri D., de Wergifosse P., Dujon B., Durand P., Entian K.-D., Eraso P., Escribano V., Fabiani L., Fartmann B., Feroli F., Feuermann M., Frontali L., Garcia-Gonzalez M., Garcia-Saez M.I., Goffeau A., Guerreiro P., Hani J., Hansen M., Hebling U., Hernandez K., Heumann K., Hilger F., Hofmann B., Indge K.J., James C.M., Klima R., Koetter P., Kramer B., Kramer W., Lauquin G., Leuther H., Louis E.J., Maillier E., Marconi A., Martegani E., Mazon M.J., Mazzoni C., McReynolds A.D.K., Melchioretto P., Mewes H.-W., Minenkova O., Mueller-Auer S., Nawrocki A., Netter P., Neu R., Nombela C., Oliver S.G., Panzeri L., Paoluzi S., Plevani P., Portetelle D., Portillo F., Potier S., Purnelle B., Rieger M., Riles L., Rinaldi T., Robben J., Rodrigues-Pousada C., Rodriguez-Belmonte E., Rodriguez-Torres A.M., Rose M., Ruzzi M., Saliola M., Sanchez-Perez M., Schaefer B., Schaefer M., Scharfe M., Schmidheini T., Schreer A., Skala J., Souciet J.-L., Steensma H.Y., Talla E., Thierry A., Vandenbol M., van der Aart Q.J.M., Van Dyck L., Vanoni M., Verhasselt P., Voet M., Volckaert G., Wambutt R., Watson M.D., Weber N., Wedler E., Wedler H., Wipfli P., Wolf K., Wright L.F., Zaccaria P., Zimmermann M., Zollner A., Kleine K.Nature 387:81-84(1997) ) Mating type-specific cell-cell recognition of Saccharomyces cerevisiae cell wall attachment and active sites of a- and alpha-agglutinin.Cappellaro C., Baldermann C., Rachel R., Tanner W.EMBO J. 13:4737-4744(1994) Interaction of alpha-agglutinin and a-agglutinin, Saccharomyces cerevisiae sexual cell adhesion molecules.Zhao H., Shen Z.M., Kahn P.C., Lipke P.N.J. Bacteriol. 183:2874-2880(2001) Global analysis of protein expression in yeast.Ghaemmaghami S., Huh W.-K., Bower K., Howson R.W., Belle A., Dephoure N., O'Shea E.K., Weissman J.S.Nature 425:737-741(2003)
ncbi gi num :
398364827
ncbi acc num :
NP_011483.3
ncbi gb acc num :
NM_001180897.3
uniprot acc num :
P32781
ncbi mol weight :
23.48kD
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.05 mg (Yeast)
price2 :
190
size3 :
0.2 mg (E-Coli)
price3 :
460
size4 :
0.2 mg (Yeast)
price4 :
460
size5 :
0.5 mg (Yeast)
price5 :
750
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!