product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Hadronyche versuta (Blue mountains funnel-web spider) (Atrax versutus) Omega-hexatoxin-Hv1a
catalog :
MBS1073255
quantity :
0.01 mg (E-Coli)
price :
115 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1073255
products type :
Recombinant Protein
products full name :
Recombinant Hadronyche versuta (Blue mountains funnel-web spider) (Atrax versutus) Omega-hexatoxin-Hv1a
products short name :
Omega-hexatoxin-Hv1a
products name syn :
Omega-atracotoxin-Hv1a; AcTx-Hv1; Omega-AcTx-Hv1a
other names :
Omega-hexatoxin-Hv1a; Omega-hexatoxin-Hv1a; Omega-atracotoxin-Hv1a; AcTx-Hv1; Omega-AcTx-Hv1a
other gene names :
Omega-HXTX-Hv1a; AcTx-Hv1; Omega-AcTx-Hv1a
uniprot entry name :
TO1A_HADVE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
Jan-37
sequence length :
37
sequence :
SPTCIPSGQPCPYNENCCSQSCTFKENENGNTVKRCD
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
other info2 :
Species: Hadronyche versuta (Blue mountains funnel-web spider) (Atrax versutus)
products description :
Reversibly and voltage-independently blocks both mid-low- (M-LVA) and high-voltage-activated (HVA) calcium channels in cockroach DUM neurons. Lethal to many insect orders but not toxic to mice or rabbits. May target the insect high-voltage-activated calcium channel Dmca1D. Also inhibits acarines calcium channels. An extremely high toxin concentration partially inhibits Cav1. 2/CACNA1C, Cav2. 1/CACNA1A and Cav2. 2/CACNA1B calcium channel of rats. As for omega-AcTx-Hv2a, the phenotypic effect of injection of this toxin into lone star ticks (Amblyomma americanum) is curling of all eight legs into closed loops.
products references :
The structure of a novel insecticidal neurotoxin, omega-atracotoxin-HV1, from the venom of an Australian funnel web spider." Fletcher J.I., Smith R., O'Donoghue S.I., Nilges M., Connor M., Howden M.E.H., Christie M.J., King G.F. Nat. Struct. Biol. 4:559-566(1997)
ncbi gi num :
2829476
ncbi acc num :
P56207.1
uniprot acc num :
P56207
ncbi mol weight :
20.05kD
size1 :
0.01 mg (E-Coli)
price1 :
115 USD
size2 :
0.05 mg (E-Coli)
price2 :
185
size3 :
0.2 mg (E-Coli)
price3 :
420
size4 :
0.5 mg (E-Coli)
price4 :
680
size5 :
1 mg (E-Coli)
price5 :
1070
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!