protein

Recombinant Human respiratory syncytial virus A Fusion glycoprotein F0

MBS1072444

0.05 mg (Yeast)

185 USD

Recombinant Protein

Recombinant Human respiratory syncytial virus A Fusion glycoprotein F0

Fusion glycoprotein F0

Fusion glycoprotein F0; Fusion glycoprotein F0

F

F; Protein F

FUS_HRSVA

E Coli or Yeast or Baculovirus or Mammalian Cell

27-529; Provide the complete extracellular domain.

529

AVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIA SGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQS CSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMS NNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTD RGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTS KTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYV NKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKS TTNIMITT
NITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIK
ENKCNGTDAKVKLIKQELDKYKN

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

During virus entry, induces fusion of viral and cellular membranes leading to delivery of the nucleocapsid into the cytoplasm. The fusogenic activity is inactive untill entry into host cell endosome, where a furin-like protease cleaves off a small peptide between F1 and F2. Interacts directly with heparan sulfate and may participates in virus attachment. Furthermore, the F2 subunit was identifed as the major determinant of RSV host cell specificity. Later in infection, proteins F expressed at the plasma membrane of infected cells can mediate fusion with adjacent cells to form syncytia, a cytopathic effect that could lead to tissue necrosis. The fusion protein is also able to trigger p53-dependent apoptosis.

Nucleotide sequence of the gene encoding the fusion (F) glycoprotein of human respiratory syncytial virus.Collins P.L., Huang Y.T., Wertz G.W.Proc. Natl. Acad. Sci. U.S.A. 81:7683-7687(1984) Nucleotide sequence analysis of the respiratory syncytial virus subgroup A cold-passaged (cp) temperature sensitive (ts) cpts-248/404 live attenuated virus vaccine candidate.Firestone C.Y., Whitehead S.S., Collins P.L., Murphy B.R., Crowe J.E. Jr.Virology 225:419-422(1996) Acquisition of the ts phenotype by a chemically mutagenized cold-passaged human respiratory syncytial virus vaccine candidate results from the acquisition of a single mutation in the polymerase (L) gene.Crowe J.E. Jr., Firestone C.Y., Whitehead S.S., Collins P.L., Murphy B.R.Virus Genes 13:269-273(1996) A cold-passaged, attenuated strain of human respiratory syncytial virus contains mutations in the F and L genes.Connors M., Crowe J.E. Jr., Firestone C.Y., Murphy B.R., Collins P.L.Virology 208:478-484(1995) Recombinant respiratory syncytial virus (RSV) bearing a set of mutations from cold-passaged RSV is attenuated in chimpanzees.Whitehead S.S., Juhasz K., Firestone C.Y., Collins P.L., Murphy B.R.J. Virol. 72:4467-4471(1998) Fatty acid acylation of the fusion glycoprotein of human respiratory syncytial virus.Arumugham R.G., Seid R.C. Jr., Doyle S., Hildreth S.W., Paradisio P.R.J. Biol. Chem. 264:10339-10342(1989) RhoA interacts with the fusion glycoprotein of respiratory syncytial virus and facilitates virus-induced syncytium formation.Pastey M.K., Crowe J.E. Jr., Graham B.S.J. Virol. 73:7262-7270(1999) The fusion glycoprotein of human respiratory syncytial virus facilitates virus attachment and infectivity via an interaction with cellular heparan sulfate.Feldman S.A., Audet S., Beeler J.A.J. Virol. 74:6442-6447(2000) The core of the respiratory syncytial virus fusion protein is a trimeric coiled coil.Matthews J.M., Young T.F., Tucker S.P., Mackay J.P.J. Virol. 74:5911-5920(2000) Furin cleavage of the respiratory syncytial virus fusion protein is not a requirement for its transport to the surface of virus-infected cells.Sugrue R.J., Brown C., Brown G., Aitken J., McL Rixon H.W.J. Gen. Virol. 82:1375-1386(2001) Cleavage of the human respiratory syncytial virus fusion protein at two distinct sites is required for activation of membrane fusion.Gonzalez-Reyes L., Ruiz-Argueello M.B., Garcia-Barreno B., Calder L., Lopez J.A., Albar J.P., Skehel J.J., Wiley D.C., Melero J.A.Proc. Natl. Acad. Sci. U.S.A. 98:9859-9864(2001) Respiratory syncytial virus (RSV) fusion protein subunit F2, not attachment protein G, determines the specificity of RSV infection.Schlender J., Zimmer G., Herrler G., Conzelmann K.K.J. Virol. 77:4609-4616(2003) The transmembrane domain of the respiratory syncytial virus F protein is an orientation-independent apical plasma membrane sorting sequence.Brock S.C., Heck J.M., McGraw P.A., Crowe J.E. Jr.J. Virol. 79:12528-12535(2005) The fusion protein of respiratory syncytial virus triggers p53-dependent apoptosis.Eckardt-Michel J., Lorek M., Baxmann D., Grunwald T., Keil G.M., Zimmer G.J. Virol. 82:3236-3249(2008) The RSV F and G glycoproteins interact to form a complex on the surface of infected cells.Low K.W., Tan T., Ng K., Tan B.H., Sugrue R.J.Biochem. Biophys. Res. Commun. 366:308-313(2008) Host cell entry of respiratory syncytial virus involves macropinocytosis followed by proteolytic activation of the F protein.Krzyzaniak M.A., Zumstein M.T., Gerez J.A., Picotti P., Helenius A.PLoS Pathog. 9:E1003309-E1003309(2013) Structural basis of respiratory syncytial virus neutralization by motavizumab.McLellan J.S., Chen M., Kim A., Yang Y., Graham B.S., Kwong P.D.Nat. Struct. Mol. Biol. 17:248-250(2010) Binding of a potent small-molecule inhibitor of six-helix bundle formation requires interactions with both heptad-repeats of the RSV fusion protein.Roymans D., De Bondt H.L., Arnoult E., Geluykens P., Gevers T., Van Ginderen M., Verheyen N., Kim H., Willebrords R., Bonfanti J.F., Bruinzeel W., Cummings M.D., van Vlijmen H., Andries K.Proc. Natl. Acad. Sci. U.S.A. 107:308-313(2010) Structure of respiratory syncytial virus fusion glycoprotein in the postfusion conformation reveals preservation of neutralizing epitopes.McLellan J.S., Yang Y., Graham B.S., Kwong P.D.J. Virol. 85:7788-7796(2011) Structural basis for immunization with postfusion respiratory syncytial virus fusion F glycoprotein (RSV F) to elicit high neutralizing antibody titers.Swanson K.A., Settembre E.C., Shaw C.A., Dey A.K., Rappuoli R., Mandl C.W., Dormitzer P.R., Carfi A.Proc. Natl. Acad. Sci. U.S.A. 108:9619-9624(2011) Structure of RSV fusion glycoprotein trimer bound to a prefusion-specific neutralizing antibody.McLellan J.S., Chen M., Leung S., Graepel K.W., Du X., Yang Y., Zhou T., Baxa U., Yasuda E., Beaumont T., Kumar A., Modjarrad K., Zheng Z., Zhao M., Xia N., Kwong P.D., Graham B.S.Science 340:1113-1117(2013) Structure-based design of a fusion glycoprotein vaccine for respiratory syncytial virus.McLellan J.S., Chen M., Joyce M.G., Sastry M., Stewart-Jones G.B., Yang Y., Zhang B., Chen L., Srivatsan S., Zheng A., Zhou T., Graepel K.W., Kumar A., Moin S., Boyington J.C., Chuang G.Y., Soto C., Baxa U., Bakker A.Q., Spits H., Beaumont T., Zheng Z., Xia N., Ko S.Y., Todd J.P., Rao S., Graham B.S., Kwong P.D.Science 342:592-598(2013)

138251

P03420.1

P03420

57.91kD

0.05 mg (Yeast)

185 USD

0.2 mg (Yeast)

420

0.5 mg (Yeast)

680

1 mg (Yeast)

1070