product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Mouse Histone H3-like centromeric protein A
catalog :
MBS1072239
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1072239
products type :
Recombinant Protein
products full name :
Recombinant Mouse Histone H3-like centromeric protein A
products short name :
Histone H3-like centromeric protein A
products name syn :
Centromere protein A; CENP-A
other names :
histone H3-like centromeric protein A isoform 2; Histone H3-like centromeric protein A; histone H3-like centromeric protein A; centromere protein A; Centromere protein A; CENP-A
products gene name :
Cenpa
other gene names :
Cenpa; Cenpa; Cenp-A; CENP-A
uniprot entry name :
CENPA_MOUSE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
1-134
sequence length :
108
sequence :
MGPRRKPQTPRRRPSSPAPGPSRQSSSVGSQTLRRRQKF
MWLKEIKTLQKSTDLLFRKKPFSMVVREICEKFSRGVDF
WWQAQALLALQEAAEAFLIHLFEDAYLLSLHAGRVTLFP
KDIQLTRRIRGFEGGLP
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Histone H3-like variant which exclusively replaces conventional H3 in the nucleosome core of centromeric chromatin at the inner plate of the kinetochore. Required for recruitment and assembly of kinetochore proteins, mitotic progression and chromosome segregation. May serve as an epigenetic mark that propagates centromere identity through replication and cell division. The CENPA-H4 heterotetramer can bind DNA by itself (in vitro).
products references :
Gene structure and sequence analysis of mouse centromere proteins A and C.Kalitsis P., Macdonald A.C., Newson A.J., Hudson D.F., Choo K.H.A.Genomics 47:108-114(1998) Centromere proteins Cenpa, Cenpb, and Bub3 interact with poly(ADP-ribose) polymerase-1 protein and are poly(ADP-ribosyl) ated.Saxena A., Saffery R., Wong L.H., Kalitsis P., Choo K.H.J. Biol. Chem. 277:26921-26926(2002)
ncbi gi num :
693582852
ncbi acc num :
NP_001289058.1
ncbi gb acc num :
NM_001302129.1
uniprot acc num :
O35216
ncbi mol weight :
17.51kD
ncbi summary :
Centromeres are the differentiated chromosomal domains that specify the mitotic behavior of chromosomes. This gene encodes a centromere protein which contains a histone H3 related histone fold domain that is required for targeting to the centromere. Centromere protein A is proposed to be a component of a modified nucleosome or nucleosome-like structure in which it replaces 1 or both copies of conventional histone H3 in the (H3-H4)2 tetrameric core of the nucleosome particle. The protein is a replication-independent histone that is a member of the histone H3 family. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Nov 2015]
uniprot summary :
CENPA: a basic nuclear protein of the histone H3 family. May act as a core histone necessary for the assembly of centromeres. Contains a histone H3 related histone fold domain that is required for targeting to the centromere. CENPA is proposed to be a component of a modified nucleosome or nucleosome-like structure in which it replaces 1 or both copies of conventional histone H3 in the (H3-H4)2 tetrameric core of the nucleosome particle. Protein type: DNA-binding. Cellular Component: chromosome; chromosome, pericentric region; condensed nuclear chromosome, pericentric region; inner kinetochore of condensed chromosome; kinetochore; nucleosome; nucleus. Molecular Function: DNA binding; protein heterodimerization activity. Biological Process: establishment of mitotic spindle orientation; kinetochore assembly
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.2 mg (E-Coli)
price2 :
460
size3 :
0.5 mg (E-Coli)
price3 :
750
size4 :
0.05 mg (Baculovirus)
price4 :
870
size5 :
0.05 mg (Mammalian-Cell)
price5 :
1095
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!