product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Sporulation membrane protein ytrH (ytrH)
catalog :
MBS1066556
quantity :
1 mg (E Coli Derived
price :
1175 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1066556
products type :
Recombinant Protein
products full name :
Recombinant Sporulation membrane protein ytrH (ytrH)
products short name :
Sporulation membrane protein ytrH (ytrH)
products name syn :
Recombinant Sporulation membrane protein ytrH (ytrH); Sporulation membrane protein ytrH
other names :
membrane proteinrocess; Sporulation membrane protein YtrH; membrane proteinrocess
products gene name syn :
ytrH; spoVIGA
other gene names :
ytrH; ytrH; spoVIGA
uniprot entry name :
YTRH_BACSU
host :
E Coli or Yeast
sequence positions :
1-113
sequence length :
113
sequence :
MDQEAGFMVNFINSYFIALGVLIGGALIGGLGAYLAGEP
PLTAITKLANRLKIWALVAAIGGTFDAVYSFERGILEGN
TRDIFKQLLLIISAMGGAQSGWLIISWLTQEHLSS
purity :
>90%
form :
This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
other info1 :
Tag Information: His tagged (Host tag may vary. Please inquire for specific tag information). Species: Bacillus subtilis
other info2 :
Storage Buffer: PBS pH 7.4, 50% glycerol
ncbi gi num :
255767674
ncbi acc num :
YP_003097771.1
ncbi gb acc num :
NC_000964.3
uniprot acc num :
C0H3P8
ncbi mol weight :
12,060 Da
uniprot summary :
Function: Involved in sporulation. May contribute to cortex formation or stability. Ref.3. Subcellular location: Forespore outer membrane; Multi-pass membrane protein . Potential. Note: Shortly after the initiation of the engulfment, is localized to the sporulation septum. During later stages of sporulation, remains associated with the forespore outer membrane. Ref.2. Induction: Transcriptionally regulated by sigma-E. Ref.2. Disruption phenotype: Impaired ability to form spores when associated with a ytrI deletion. In combination with a ybaN deletion, cells show a severe sporulation defect. Ref.3
size :
1 mg (E Coli Derived)
price :
1175 USD
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!