WISAQKDIISYVDETEAATSTITKNQDAQNNWLTQQANL
SPAPKGFIIAPENGSGVGTAVNTIADKGIPIVAYDRLIT
GSDKYDWYVSFDNEKVGELQGLSLAAGLLGKEDGAFDSI
DQMNEYLKSHMPQETISFYTIAGSQDDNNSQYFYNGAMK
VLKELMKNSQNKIIDLSPEGENAVYVPGWNYGTAGQRIQ
SFLTINKDPAGGNKIKAVGSK

San Diego, CA 92195-3308
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!
- Recombinant Epstein-Barr virus Envelope glycoprotein B (gB) | MBS1071633
- Recombinant Brugia malayi Protein JTB (JTB) | MBS1075129
- Recombinant Human Elongation factor 1-alpha 1 | MBS1075765
- Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Adhesin yadA (yadA ...
- Recombinant Human Laforin (EPM2A) | MBS1085145