product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Leiurus quinquestriatus hebraeus (Yellow scorpion) Alpha-insect toxin LqhaIT
catalog :
MBS1064984
quantity :
0.05 mg (E-Coli)
price :
180 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1064984
products type :
Recombinant Protein
products full name :
Recombinant Leiurus quinquestriatus hebraeus (Yellow scorpion) Alpha-insect toxin LqhaIT
products short name :
Alpha-insect toxin LqhaIT
products name syn :
Lqh-alpha-IT; Alpha-IT
other names :
Alpha-insect toxin LqhaIT; Alpha-insect toxin LqhaIT; Lqh-alpha-IT; Alpha-IT
other gene names :
Alpha-IT; Alpha-IT
uniprot entry name :
SCXA_LEIQH
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
20-85, Mature full length protein
sequence length :
85
sequence :
VRDAYIAKNYNCVYECFRDAYCNELCTKNGASSGYCQWA
GKYGNACWCYALPDNVPIRVPGKCHRK
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
other info2 :
Species: Leiurus quinquestriatus hebraeus (Yellow scorpion)
products description :
Alpha toxins bind voltage-independently at site-3 of sodium channels (Nav) and inhibit the inactivation of the activated channels, thereby blocking neuronal transmission. The dissociation is voltage-dependent. This toxin is active on insects. It is also highly toxic to crustaceans and has a measurable but low toxicity to mice.
products references :
Nucleotide sequence and structure analysis of a cDNA encoding an alpha insect toxin from the scorpion Leiurus quinquestriatus hebraeus." Gurevitz M., Urbach D., Zlotkin E., Zilberberg N. Toxicon 29:1270-1272(1991)
ncbi gi num :
134374
ncbi acc num :
P17728.2
uniprot acc num :
P17728
ncbi mol weight :
23.52kD
size1 :
0.05 mg (E-Coli)
price1 :
180 USD
size2 :
0.2 mg (E-Coli)
price2 :
490
size3 :
0.5 mg (E-Coli)
price3 :
715
size4 :
0.05 mg (Baculovirus)
price4 :
835
size5 :
0.05 mg (Mammalian-Cell)
price5 :
1055
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!