catalog number :
MBS1061410
products type :
Recombinant Protein
products full name :
Recombinant Salmonella typhimurium Protein prgJ (prgJ)
products short name :
[Protein prgJ (prgJ)]
products name syn :
[Protein prgJ]
other names :
[secretion system protein PrgJ; Protein PrgJ; secretion system protein PrgJ]
products gene name :
[prgJ]
products gene name syn :
[prgJ; STM2872]
other gene names :
[prgJ; prgJ; STM2872]
uniprot entry name :
PRGJ_SALTY
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[1-101. Full Length]
sequence :
MSIATIVPENAVIGQAVNIRSMETDIVSLDDRLLQAFSG
SAIATAVDKQTITNRIEDPNLVTDPKELAISQEMISDYN
LYVSMVSTLTRKGVGAVETLLRS
form :
Liquid containing glycerol
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
image1 heading :
SDS-Page
other info1 :
Species: Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
other info2 :
Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.
products description :
Required for invasion of epithelial cells.
ncbi acc num :
NP_461793.1
ncbi gb acc num :
NC_003197.1
ncbi mol weight :
10,926 Da
ncbi pathways :
Immune System Pathway (106386); Inflammasomes Pathway (366166); Innate Immune System Pathway (106387); Nucleotide-binding Domain, Leucine Rich Repeat Containing Receptor (NLR) Signaling Pathways (366164); The IPAF Inflammasome Pathway (366169)
uniprot summary :
Required for invasion of epithelial cells.
size8 :
0.05 mg (Baculovirus)
size10 :
0.05 mg (Mammalian-Cell)
size12 :
0.1 mg (Baculovirus)
size14 :
0.5 mg (Baculovirus)
size16 :
0.1 mg (Mammalian-Cell)
size18 :
1 mg (Baculovirus)