protein

Recombinant Human Sodium-dependent phosphate transport protein 2B

MBS1061365

0.05 mg (E-Coli)

190 USD

Recombinant Protein

Recombinant Human Sodium-dependent phosphate transport protein 2B

Sodium-dependent phosphate transport protein 2B

Na(+)-dependent phosphate cotransporter 2B; NaPi3b; Sodium/phosphate cotransporter 2B; Na(+)/Pi cotransporter 2B; NaPi-2b; Solute carrier family 34 member 2

sodium-dependent phosphate transport protein 2B isoform b; Sodium-dependent phosphate transport protein 2B; sodium-dependent phosphate transport protein 2B; solute carrier family 34 (type II sodium/phosphate cotransporter), member 2; Na(+)-dependent phosphate cotransporter 2B; NaPi3b; Sodium/phosphate cotransporter 2B; Na(+)/Pi cotransporter 2B; NaPi-2b; Solute carrier family 34 member 2

SLC34A2

SLC34A2; SLC34A2; NPTIIb; NAPI-3B; NAPI-IIb; Sodium-phosphate transport protein 2B; Na(+)/Pi cotransporter 2B; NaPi-2b

NPT2B_HUMAN

E Coli or Yeast or Baculovirus or Mammalian Cell

574-689

689

LLQSRCPRVLPKKLQNWNFLPLWMRSLKPWDAVVSKFTG
CFQMRCCCCCRVCCRACCLLCDCPKCCRCSKCCEDLEEA
QEGQDVPVKAPETFDNITISREAQGEVPASDSKTECTA

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Signal Transduction

May be involved in actively transporting phosphate into cells via Na+ cotransport. It may be the main phosphate transport protein in the intestinal brush border membrane. May have a role in the synthesis of surfactant in lungs' alveoli.

Cloning and functional characterization of a sodium-dependent phosphate transporter expressed in human lung and small intestine.Feild J.A., Zhang L., Brun K.A., Brooks D.P., Edwards R.M.Biochem. Biophys. Res. Commun. 258:578-582(1999) Molecular cloning, functional characterization, tissue distribution, and chromosomal localization of a human, small intestinal sodium-phosphate (Na+-Pi) transporter (SLC34A2) .Xu H., Bai L., Collins J.F., Ghishan F.K.Genomics 62:281-284(1999) Generation and annotation of the DNA sequences of human chromosomes 2 and 4.Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H., Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.Nature 434:724-731(2005) Regulation of the human sodium-phosphate cotransporter NaPi-IIb gene promoter by epidermal growth factor.Xu H., Collins J.F., Bai L., Kiela P.R., Ghishan F.K.Am. J. Physiol. 280:C628-C636(2001) Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) Fusion of FIG to the receptor tyrosine kinase ROS in a glioblastoma with an interstitial del(6) (q21q21) .Charest A., Lane K., McMahon K., Park J., Preisinger E., Conroy H., Housman D.Genes Chromosomes Cancer 37:58-71(2003) Mutations in SLC34A2 cause pulmonary alveolar microlithiasis and are possibly associated with testicular microlithiasis.Corut A., Senyigit A., Ugur S.A., Altin S., Ozcelik U., Calisir H., Yildirim Z., Gocmen A., Tolun A.Am. J. Hum. Genet. 79:650-656(2006)

295789158

NP_001171469.1

NM_001177998.1

O95436

15.11kD

Metabolism Of Proteins Pathway (1268677); Mineral Absorption Pathway (212237); Mineral Absorption Pathway (212220); SLC-mediated Transmembrane Transport Pathway (1269907); Sodium-coupled Phosphate Cotransporters Pathway (1269914); Surfactant Metabolism Pathway (1309223); Transmembrane Transport Of Small Molecules Pathway (1269903); Transport Of Inorganic Cations/anions And Amino Acids/oligopeptides Pathway (1269908); Type II Na+/Pi Cotransporters Pathway (1269915)

The protein encoded by this gene is a pH-sensitive sodium-dependent phosphate transporter. Phosphate uptake is increased at lower pH. Defects in this gene are a cause of pulmonary alveolar microlithiasis. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, May 2010]

SLC34A2: May be involved in actively transporting phosphate into cells via Na(+) cotransport. It may be the main phosphate transport protein in the intestinal brush border membrane. May have a role in the synthesis of surfactant in lungs' alveoli. Defects in SLC34A2 are a cause of pulmonary alveolar microlithiasis (PALM). Pulmonary alveolar microlithiasis is a rare disease characterized by the deposition of calcium phosphate microliths throughout the lungs. Most patients are asymptomatic for several years or even for decades and generally, the diagnosis is incidental to clinical investigations unrelated to the disease. Cases with early onset or rapid progression are rare. A 'sandstorm-appearing' chest roentgenogram is a typical diagnostic finding. The onset of this potentially lethal disease varies from the neonatal period to old age and the disease follows a long-term, progressive course, resulting in a slow deterioration of lung functions. Pulmonary alveolar microlithiasis is a recessive monogenic disease with full penetrance. A chromosomal aberration involving SLC34A2 is found in a non-small cell lung cancer cell line. Results in the formation of a SLC34A2-ROS1 chimeric protein that retains a constitutive kinase activity. Belongs to the SLC34A transporter family. 2 isoforms of the human protein are produced by alternative splicing. Protein type: Membrane protein, integral; Transporter, SLC family; Membrane protein, multi-pass; Transporter. Chromosomal Location of Human Ortholog: 4p15.2. Cellular Component: apical plasma membrane; brush border membrane; integral to membrane; integral to plasma membrane; plasma membrane; vesicle. Molecular Function: phosphate binding; sodium ion binding; sodium-dependent phosphate transmembrane transporter activity; sodium:phosphate symporter activity. Biological Process: cellular phosphate ion homeostasis; cellular protein metabolic process; in utero embryonic development; ion transport; phosphate transport; response to estrogen stimulus; transmembrane transport. Disease: Pulmonary Alveolar Microlithiasis; Testicular Microlithiasis

0.05 mg (E-Coli)

190 USD

0.2 mg (E-Coli)

460

0.5 mg (E-Coli)

750

1 mg (E-Coli)

1180

1 mg (Yeast)

1655