protein

Recombinant Human respiratory syncytial virus A (strain A2) Major surface glycoprotein G

MBS1059692

0.05 mg (E-Coli)

190 USD

Recombinant Protein

Recombinant Human respiratory syncytial virus A (strain A2) Major surface glycoprotein G

Major surface glycoprotein G

Attachment glycoprotein G; Membrane-bound glycoprotein; mG

Major surface glycoprotein G; Major surface glycoprotein G; Attachment glycoprotein G; Membrane-bound glycoprotein; mG

G

G; mG

GLYC_HRSVA

E Coli or Yeast or Baculovirus or Mammalian Cell

67-298

298

HKVTPTTAIIQDATSQIKNTTPTYLTQNPQLGISPSNPS
EITSQITTILASTTPGVKSTLQSTTVKTKNTTTTQTQPS
KPTTKQRQNKPPSKPNNDFHFEVFNFVPCSICSNNPTCW
AICKRIPNKKPGKKTTTKPTKKPTLKTTKKDPKPQTTKS
KEVPTTKPTEEPTINTTKTNIITTLLTSNTTGNPELTSQ
METFHSTSSEGNPSPSQVSTTSEYPSQPSSPPNTPRQ

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Attaches the virion to the host cell membrane by interacting with heparan sulfate, initiating the infection. Interacts with host CX3CR1, the receptor for the CX3C chokine fractalkine, to modulate the immune response and facilitate infection. Unlike the other paramyxovirus attachment proteins, lacks both neuraminidase and hagglutinating activities. Secreted glycoprotein G helps RSV escape antibody-dependent restriction of replication by acting as an antigen decoy and by modulating the activity of leukocytes bearing Fcgamma receptors.

Nucleotide sequence of the G protein gene of human respiratory syncytial virus reveals an unusual type of viral membrane protein.Wertz G.W., Collins P.L., Huang Y., Gruber C., Levine S., Ball L.A.Proc. Natl. Acad. Sci. U.S.A. 82:4075-4079(1985) A cold-passaged, attenuated strain of human respiratory syncytial virus contains mutations in the F and L genes.Connors M., Crowe J.E. Jr., Firestone C.Y., Murphy B.R., Collins P.L.Virology 208:478-484(1995) The membrane-associated and secreted forms of the respiratory syncytial virus attachment glycoprotein G are synthesized from alternative initiation codons.Roberts S.R., Lichtenstein D., Ball L.A., Wertz G.W.J. Virol. 68:4538-4546(1994) Identification of a linear heparin binding domain for human respiratory syncytial virus attachment glycoprotein G.Feldman S.A., Hendry R.M., Beeler J.A.J. Virol. 73:6610-6617(1999) The fusion glycoprotein of human respiratory syncytial virus facilitates virus attachment and infectivity via an interaction with cellular heparan sulfate.Feldman S.A., Audet S., Beeler J.A.J. Virol. 74:6442-6447(2000) CX3C chemokine mimicry by respiratory syncytial virus G glycoprotein.Tripp R.A., Jones L.P., Haynes L.M., Zheng H., Murphy P.M., Anderson L.J.Nat. Immunol. 2:732-738(2001) The respiratory syncytial virus small hydrophobic protein is phosphorylated via a mitogen-activated protein kinase p38-dependent tyrosine kinase activity during virus infection.Rixon H.W., Brown G., Murray J.T., Sugrue R.J.J. Gen. Virol. 86:375-384(2005) Interaction between the respiratory syncytial virus G glycoprotein cytoplasmic domain and the matrix protein.Ghildyal R., Li D., Peroulis I., Shields B., Bardin P.G., Teng M.N., Collins P.L., Meanger J., Mills J.J. Gen. Virol. 86:1879-1884(2005) The RSV F and G glycoproteins interact to form a complex on the surface of infected cells.Low K.W., Tan T., Ng K., Tan B.H., Sugrue R.J.Biochem. Biophys. Res. Commun. 366:308-313(2008) The secreted form of respiratory syncytial virus G glycoprotein helps the virus evade antibody-mediated restriction of replication by acting as an antigen decoy and through effects on fc receptor-bearing leukocytes.Bukreyev A., Yang L., Fricke J., Cheng L., Ward J.M., Murphy B.R., Collins P.L.J. Virol. 82:12191-12204(2008)

138294

P03423.1

P03423

41.2kD

0.05 mg (E-Coli)

190 USD

0.2 mg (E-Coli)

460

0.5 mg (E-Coli)

750

1 mg (E-Coli)

1180

1 mg (Yeast)

1620