Recombinant Bordetella pertussis Pertactin autotransporter (prn), partial | MyBioSource MBS1059256 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Bordetella pertussis Pertactin autotransporter (prn), partial

catalog :

MBS1059256

quantity :

0.01 mg (E-Coli)

price :

235 USD

more info or order :

MyBioSource product webpage

image

image 1 :

product information

catalog number :

MBS1059256

products type :

Recombinant Protein

products full name :

Recombinant Bordetella pertussis Pertactin autotransporter (prn), partial

products short name :

[Pertactin autotransporter (prn)]

products name syn :

[P.93]

other names :

[pertactin autotransporter; Pertactin autotransporter; pertactin autotransporter; P.93]

products gene name :

[prn]

other gene names :

[prn; prn; omp69A]

uniprot entry name :

PERT_BORPE

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

[632-910aa; Partial]

sequence length :

910

sequence :

ALSKRLGELRLNPDAGGAWGRGFAQRQQLDNRAGRRFDQ
KVAGFELGADHAVAVAGGRWHLGGLAGYTRGDRGFTGDG
GGHTDSVHVGGYATYIADSGFYLDATLRASRLENDFKVA
GSDGYAVKGKYRTHGVGASLEAGRRFTHADGWFLEPQAE
LAVFRAGGGAYRAANGLRVRDEGGSSVLGRLGLEVGKRI
ELAGGRQVQPYIKASVLQEFDGAGTVHTNGIAHRTELRG
TRAELGLGMAAALGRGHSLYASYEYSKGPKLAMPWTFHA
GYRYSW

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

image1 heading :

SDS-Page

other info2 :

Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.

products description :

Agglutinogen that binds to eukaryotic cells; a process mediated by the R-G-D sequence. Pertactin may have a role in bacterial adhesion, and thus play a role in virulence. May contribute to the disease state of whooping cough.

products references :

Molecular cloning and characterization of protective outer membrane protein P.69 from Bordetella pertussis.Charles I.G., Dougan G., Pickard D., Chatfield S., Smith M., Novotny P., Morrissey P., Fairweather N.F.Proc. Natl. Acad. Sci. U.S.A. 86:3554-3558(1989) Cloning, nucleotide sequence and heterologous expression of the protective outer-membrane protein P.68 pertactin from Bordetella bronchiseptica.Li J.L., Fairweather N.F., Novotny P., Dougan G., Charles I.G.J. Gen. Microbiol. 138:1697-1705(1992) Comparative analysis of the genome sequences of Bordetella pertussis, Bordetella parapertussis and Bordetella bronchiseptica.Parkhill J., Sebaihia M., Preston A., Murphy L.D., Thomson N.R., Harris D.E., Holden M.T.G., Churcher C.M., Bentley S.D., Mungall K.L., Cerdeno-Tarraga A.-M., Temple L., James K.D., Harris B., Quail M.A., Achtman M., Atkin R., Baker S., Basham D., Bason N., Cherevach I., Chillingworth T., Collins M., Cronin A., Davis P., Doggett J., Feltwell T., Goble A., Hamlin N., Hauser H., Holroyd S., Jagels K., Leather S., Moule S., Norberczak H., O'Neil S., Ormond D., Price C., Rabbinowitsch E., Rutter S., Sanders M., Saunders D., Seeger K., Sharp S., Simmonds M., Skelton J., Squares R., Squares S., Stevens K., Unwin L., Whitehead S., Barrell B.G., Maskell D.J.Nat. Genet. 35:32-40(2003) Crystallization and preliminary X-ray diffraction analysis of P30, the transmembrane domain of pertactin, an autotransporter from Bordetella pertussis.Zhu Y., Black I., Roszak A.W., Isaacs N.W.Acta Crystallogr. F 63:593-595(2007) Structure of Bordetella pertussis virulence factor P.69 pertactin.Emsley P., Charles I.G., Fairweather N.F., Isaacs N.W.Nature 381:90-92(1996)

ncbi gi num :

33592195

ncbi acc num :

NP_879839.1

ncbi gb acc num :

NC_002929.2

uniprot acc num :

P14283

ncbi mol weight :

45.8kD

ncbi pathways :

Pertussis Pathway (218102); Pertussis Pathway (218099)

uniprot summary :

size1 :

0.01 mg (E-Coli)

price1 :

235 USD

size2 :

0.05 mg (E-Coli)

price2 :

320

size3 :

0.1 mg (E-Coli)

price3 :

535

size4 :

0.2 mg (E-Coli)

price4 :

855

size5 :

0.5 mg (E-Coli)

price5 :

1125

size6 :

1 mg (E-Coli)

price6 :

1725

more info or order :

MyBioSource product webpage