Recombinant Rat Osteocalcin | MyBioSource MBS1058077 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Rat Osteocalcin

catalog :

MBS1058077

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS1058077

products type :

Recombinant Protein

products full name :

Recombinant Rat Osteocalcin

products short name :

Osteocalcin

products name syn :

Bone Gla protein; BGP; Gamma-carboxyglutamic acid-containing protein

other names :

osteocalcin preproprotein; Osteocalcin; osteocalcin; bone gamma-carboxyglutamate (gla) protein; Bone Gla protein; BGP; Gamma-carboxyglutamic acid-containing protein

products gene name :

Bglap

other gene names :

Bglap; Bglap; Bgp; Bgpr; Bgpra; Bglap2; Bglap2; BGP

uniprot entry name :

OSTCN_RAT

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

50-99aa; Provide the mature full length of Osteocalcin protein with complete protein structure, contains all metal binding sites

sequence :

YLNNGLGAPAPYPDPLEPHREVCELNPNCDELADHIGFQ
DAYKRIYGTTV

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products description :

Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium.

products references :

Isolation of the human gene for bone gla protein utilizing mouse and rat cDNA clones.Celeste A.J., Buecker J.L., Kriz R., Wang E.A., Wozney J.M.EMBO J. 5:1885-1890(1986) The propeptide of rat bone gamma-carboxyglutamic acid protein shares homology with other vitamin K-dependent protein precursors.Pan L.C., Price P.A.Proc. Natl. Acad. Sci. U.S.A. 82:6109-6113(1985) Characterization of the rat osteocalcin gene stimulation of promoter activity by 1,25-dihydroxyvitamin D3.Yoon K., Rutledge S.J.C., Buenaga R.F., Rodan G.A.Biochemistry 27:8521-8526(1988) Molecular structure of the rat bone Gla protein gene and identification of putative regulatory elements.Theofan G., Haberstroh L.M., Price P.A.DNA 8:213-221(1989) Structure of the rat osteocalcin gene and regulation of vitamin D-dependent expression.Lian J., Stewart C., Puchacz E., Mackowiak S., Shalhoub V., Collart D., Zambetti G., Stein G.Proc. Natl. Acad. Sci. U.S.A. 86:1143-1147(1989)

ncbi gi num :

11761543

ncbi acc num :

NP_038200.1

ncbi gb acc num :

NM_013414.1

uniprot acc num :

P04640

ncbi mol weight :

33kD

ncbi pathways :

Gamma Carboxylation, Hypusine Formation And Arylsulfatase Activation Pathway (1334042); Gamma-carboxylation Of Protein Precursors Pathway (1334044); Gamma-carboxylation, Transport, And Amino-terminal Cleavage Of Proteins Pathway (1334043); Metabolism Of Proteins Pathway (1334037); Osteoblast Pathway (198455); Post-translational Protein Modification Pathway (1334041); Removal Of Aminoterminal Propeptides From Gamma-carboxylated Proteins Pathway (1334046); Transport Of Gamma-carboxylated Protein Precursors From The Endoplasmic Reticulum To The Golgi Apparatus Pathway (1334045)

ncbi summary :

highly conserved protein associated with mineralized bone matrix; protein is secreted by calcified tissues and is regulated by vitamin D3 [RGD, Feb 2006]

uniprot summary :

osteocalcin: Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium. Belongs to the osteocalcin/matrix Gla protein family. Protein type: Secreted; Secreted, signal peptide; Cell development/differentiation. Cellular Component: cell projection; cytoplasm; dendrite; extracellular region; extracellular space; Golgi apparatus; perikaryon; rough endoplasmic reticulum. Molecular Function: calcium ion binding; structural constituent of bone. Biological Process: aging; biomineral formation; cell aging; odontogenesis; ossification; osteoblast development; osteoblast differentiation; regulation of bone mineralization; response to activity; response to drug; response to estrogen stimulus; response to ethanol; response to glucocorticoid stimulus; response to gravity; response to hydroxyisoflavone; response to inorganic substance; response to mechanical stimulus; response to nutrient levels; response to organic cyclic substance; response to testosterone stimulus; response to vitamin D; response to vitamin K; response to zinc ion

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.2 mg (E-Coli)

price2 :

460

size3 :

0.05 mg (Baculovirus)

price3 :

750

size4 :

0.5 mg (E-Coli)

price4 :

750

size5 :

0.05 mg (Mammalian-Cell)

price5 :

1055

more info or order :

MyBioSource product webpage