catalog number :
MBS1056262
products type :
Recombinant Protein
products full name :
Recombinant Escherichia coli Tetracycline repressor protein class B from transposon Tn10 (tetR)
products short name :
[Tetracycline repressor protein class B from transposon Tn10 (tetR)]
other names :
[MULTISPECIES: transposase; Tetracycline repressor protein class B from transposon Tn10; tetracycline repressor protein]
products gene name :
[tetR]
other gene names :
[D616_p109083; tetR]
uniprot entry name :
TETR2_ECOLX
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[1-207. Full Length]
sequence :
MSRLDKSKVINSALELLNEVGIEGLTTRKLAQKLGVEQP
TLYWHVKNKRALLDALAIEMLDRHHTHFCPLEGESWQDF
LRNNAKSFRCALLSHRDGAKVHLGTRPTEKQYETLENQL
AFLCQQGFSLENALYALSAVGHFTLGCVLEDQEHQVAKE
ERETPTTDSMPPLLRQAIELFDHQGAEPAFLFGLELIIC
GLEKQLKCESGS
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
image1 heading :
SDS-Page
other info2 :
Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.
products description :
TetR is the repressor of the tetracycline resistance element; its N-terminal region forms a helix-turn-helix structure and binds DNA. Binding of tetracycline to TetR reduces the repressor affinity for the tetracycline resistance gene (tetA) promoter operator sites.
products references :
Nucleotide sequence of the repressor gene of the TN10 tetracycline resistance determinant.Postle K., Nguyen T.T., Bertrand K.P.Nucleic Acids Res. 12:4849-4863(1984)
A threonine to alanine exchange at position 40 of Tet repressor alters the recognition of the sixth base pair of tet operator from GC to AT.Altschmied L., Baumeister R., Pfleiderer K., Hillen W.EMBO J. 7:4011-4017(1988)
Overlapping divergent promoters control expression of Tn10 tetracycline resistance.Bertrand K.P., Postle K., Wray L.V. Jr., Reznikoff W.S.Gene 23:149-156(1983)
Mutations in the Tn10 tet repressor that interfere with induction. Location of the tetracycline-binding domain.Smith L.D., Bertrand K.P.J. Mol. Biol. 203:949-959(1988)
ncbi acc num :
WP_000088605.1
ncbi gb acc num :
WP_000088605.1
ncbi mol weight :
39.34kD
uniprot summary :
TetR is the repressor of the tetracycline resistance element; its N-terminal region forms a helix-turn-helix structure and binds DNA. Binding of tetracycline to TetR reduces the repressor affinity for the tetracycline resistance gene (tetA) promoter operator sites.
size6 :
0.05 mg (Baculovirus)
size10 :
0.05 mg (Mammalian-Cell)
size11 :
0.1 mg (Baculovirus)
size14 :
0.5 mg (Baculovirus)
size15 :
0.1 mg (Mammalian-Cell)
size16 :
1 mg (Baculovirus)