Recombinant Shigella flexneri serotype X E3 ubiquitin-protein ligase ipaH9.8 | MyBioSource MBS1056130 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Shigella flexneri serotype X E3 ubiquitin-protein ligase ipaH9.8

catalog :

MBS1056130

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS1056130

products type :

Recombinant Protein

products full name :

Recombinant Shigella flexneri serotype X E3 ubiquitin-protein ligase ipaH9.8

products short name :

E3 ubiquitin-protein ligase ipaH9.8

products name syn :

Invasion plasmid antigen ipa; H9.8

other names :

invasion plasmid antigen, secreted by the Mxi-Spa secretion machinery (plasmid); E3 ubiquitin-protein ligase ipaH9.8; invasion plasmid antigen, secreted by the Mxi-Spa secretion machinery; Invasion plasmid antigen ipaH9.8

products gene name :

ipaH9.8

other gene names :

ipaH9.8; ipaH9.8

uniprot entry name :

IPA9_SHIFL

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

1-545

sequence length :

545

sequence :

MLPINNNFSLPQNSFYNTISGTYADYFSAWDKWEKQALP
GEERDEAVSRLKECLINNSDELRLDRLNLSSLPDNLPAQ
ITLLNVSYNQLTNLPELPVTLKKLYSASNKLSELPVLPP
ALESLQVQHNELENLPALPDSLLTMNISYNEIVSLPSLP
QALKNLRATRNFLTELPAFSEGNNPVVREYFFDRNQISH
IPESILNLRNECSIHISDNPLSSHALQALQRLTSSPDYH
GPRIYFSMSDGQQNTLHRPLA

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products description :

Effector proteins function to alter host cell physiology and promote bacterial survival in host tissues. This protein is an E3 ubiquitin ligase that interferes with host's ubiquitination pathway and modulates the acute inflammatory responses, thus facilitating bacterial colonization within the host cell. Interacts with IKBKG (NO) and TNIP1 (ABIN-1), a ubiquitin-binding adapter protein, which results in TNIP1-dependent 'Lys-27'-linked polyubiquitination of IKBKG. Consequently, polyubiquitinated IKBKG undergoes proteasome-dependent degradation, which perturbs NF-kappa-B activation during bacterial infection. Uses UBE2D2 (UBCH5B) as an E2 ubiquitin-conjugating enzyme. Mediates polyubiquitination of host U2AF1, leading to its proteasomal degradation.

products references :

Induction of type III secretion in Shigella flexneri is associated with differential control of transcription of genes encoding secreted proteins.Demers B., Sansonetti P.J., Parsot C.EMBO J. 17:2894-2903(1998) The virulence plasmid pWR100 and the repertoire of proteins secreted by the type III secretion apparatus of Shigella flexneri.Buchrieser C., Glaser P., Rusniok C., Nedjari H., d'Hauteville H., Kunst F., Sansonetti P.J., Parsot C.Mol. Microbiol. 38:760-771(2000) Complete DNA sequence and analysis of the large virulence plasmid of Shigella flexneri.Venkatesan M.M., Goldberg M.B., Rose D.J., Grotbeck E.J., Burland V., Blattner F.R.Infect. Immun. 69:3271-3285(2001) Comparison of two major forms of the Shigella virulence plasmid pINV positive selection is a major force driving the divergence.Lan R., Stevenson G., Reeves P.R.Infect. Immun. 71:6298-6306(2003) Comparison of the virulence plasmid genomes of two strains of Shigella which lost the ability to bind Congo red.Xiong Z., Tang X., Yang F., Zhang X., Yang J., Chen L., Nie H., Yan Y., Jiang Y., Wang J., Xue Y., Xu X., Zhu Y., Dong J., An L., Wang X., Jin Q.Sci. China, Ser. C, Life Sci. 49:141-148(2006) Genome sequence of Shigella flexneri 2a insights into pathogenicity through comparison with genomes of Escherichia coli K12 and O157.Jin Q., Yuan Z., Xu J., Wang Y., Shen Y., Lu W., Wang J., Liu H., Yang J., Yang F., Zhang X., Zhang J., Yang G., Wu H., Qu D., Dong J., Sun L., Xue Y., Zhao A., Gao Y., Zhu J., Kan B., Ding K., Chen S., Cheng H., Yao Z., He B., Chen R., Ma D., Qiang B., Wen Y., Hou Y., Yu J.Nucleic Acids Res. 30:4432-4441(2002) Shigella protein IpaH(9.8) is secreted from bacteria within mammalian cells and transported to the nucleus.Toyotome T., Suzuki T., Kuwae A., Nonaka T., Fukuda H., Imajoh-Ohmi S., Toyofuku T., Hori M., Sasakawa C.J. Biol. Chem. 276:32071-32079(2001) Shigella effector IpaH9.8 binds to a splicing factor U2AF(35) to modulate host immune responses.Okuda J., Toyotome T., Kataoka N., Ohno M., Abe H., Shimura Y., Seyedarabi A., Pickersgill R., Sasakawa C.Biochem. Biophys. Res. Commun. 333:531-539(2005) Type III secretion effectors of the IpaH family are E3 ubiquitin ligases.Rohde J.R., Breitkreutz A., Chenal A., Sansonetti P.J., Parsot C.Cell Host Microbe 1:77-83(2007) A bacterial E3 ubiquitin ligase IpaH9.8 targets NEMO/IKKgamma to dampen the host NF-kappaB-mediated inflammatory response.Ashida H., Kim M., Schmidt-Supprian M., Ma A., Ogawa M., Sasakawa C.Nat. Cell Biol. 12:66-73(2010) Structure of an SspH1-PKN1 complex reveals the basis for host substrate recognition and mechanism of activation for a bacterial E3 ubiquitin ligase.Keszei A.F., Tang X., McCormick C., Zeqiraj E., Rohde J.R., Tyers M., Sicheri F.Mol. Cell. Biol. 34:362-373(2014) A disulfide driven domain swap switches off the activity of Shigella IpaH9.8 E3 ligase.Seyedarabi A., Sullivan J.A., Sasakawa C., Pickersgill R.W.FEBS Lett. 584:4163-4168(2010)

ncbi gi num :

56404031

ncbi acc num :

NP_858359.2

ncbi gb acc num :

NC_004851.1

uniprot acc num :

Q8VSC3

ncbi mol weight :

66.1kD

ncbi pathways :

Shigellosis Pathway (151780)

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.05 mg (Yeast)

price2 :

190

size3 :

0.2 mg (E-Coli)

price3 :

460

size4 :

0.2 mg (Yeast)

price4 :

460

size5 :

0.5 mg (E-Coli)

price5 :

750

more info or order :

MyBioSource product webpage