catalog number :
MBS1055882
products type :
Recombinant Protein
products full name :
Recombinant Pig Pro-opiomelanocortin (POMC)
products short name :
[Pro-opiomelanocortin (POMC)]
products name syn :
[Pro-opiomelanocortin; POMC; Corticotropin-lipotropinCleaved into the following 10 chains:; 1. NPP; 2. Melanotropin gamma; Gamma-MSH; Corticotropin; Adrenocorticotropic hormone; ACTH; Melanotropin alpha; Alpha-MSH; Corticotropin-like intermediary peptide;]
other names :
[pro-opiomelanocortin; Pro-opiomelanocortin; pro-opiomelanocortin; corticotropin-lipotropin; proopiomelanocortin (adrenocorticotropin/ beta-lipotropin/ alpha-melanocyte stimulating hormone/ beta-melanocyte stimulating hormone/ beta-endorphin); Corticotropin-lipotropinCleaved into the following 10 chains:NPP; Melanotropin gammaAlternative name(s):Gamma-MSH]
products gene name :
[POMC]
other gene names :
[POMC; POMC; POMC; ACTH; CLIP]
uniprot entry name :
COLI_PIG
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[27-106. partial protein;]
sequence :
WCLESSQCQDLSTESNLLACIRACKPDLSAETPVFPGNG
DAQPLTENPRKYVMGHFRWDRFGRRNGSSSGGGGGGGGA
GQ
form :
Liquid containing glycerol
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
other info1 :
Species: Sus scrofa (Pig)
products description :
This gene encodes a polypeptide hormone precursor that undergoes extensive, tissue-specific, post-translational processing via cleavage by subtilisin-like enzymes known as prohormone convertases. There are eight potential cleavage sites within the polypeptide precursor and, depending on tissue type and the available convertases, processing may yield as many as ten biologically active peptides involved in diverse cellular functions. The encoded protein is synthesized mainly in corticotroph cells of the anterior pituitary where four cleavage sites are used; adrenocorticotrophin, essential for normal steroidogenesis and the maintenance of normal adrenal weight, and lipotropin beta are the major end products. In other tissues, including the hypothalamus, placenta, and epithelium, all cleavage sites may be used, giving rise to peptides with roles in pain and energy homeostasis, melanocyte stimulation, and immune modulation. These include several distinct melanotropins, lipotropins, and endorphins that are contained within the adrenocorticotrophin and beta-lipotropin peptides. Mutations in this gene have been associated with early onset obesity, adrenal insufficiency, and red hair pigmentation. Alternatively spliced transcript variants encoding the same protein have been described.
ncbi acc num :
NP_999023.1
ncbi gb acc num :
NM_213858.1
ncbi mol weight :
28,895 Da
ncbi pathways :
Adipocytokine Signaling Pathway (84504); Adipocytokine Signaling Pathway (505); Melanogenesis Pathway (84503); Melanogenesis Pathway (504)
uniprot summary :
ACTH stimulates the adrenal glands to release cortisol.
size5 :
0.05 mg (Baculovirus)
size9 :
0.1 mg (Baculovirus)
size10 :
0.05 mg (Mammalian-Cell)
size11 :
0.5 mg (Baculovirus)
size13 :
0.1 mg (Mammalian-Cell)
size14 :
1 mg (Baculovirus)