product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Saccharomyces cerevisiae (strain ATCC 204508 / S288c) Translation initiation factor IF-2, mitochondrial
catalog :
MBS1049924
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1049924
products type :
Recombinant Protein
products full name :
Recombinant Saccharomyces cerevisiae (strain ATCC 204508 / S288c) Translation initiation factor IF-2, mitochondrial
products short name :
Translation initiation factor IF-2, mitochondrial
other names :
translation initiation factor 2; Translation initiation factor IF-2, mitochondrial; translation initiation factor 2
products gene name :
IFM1
other gene names :
IFM1; IFM1; IF-2(Mt); IF-2Mt; IF2(mt)
uniprot entry name :
IF2M_YEAST
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
43-676
sequence length :
676
sequence :
KGKRRNQISKKELKPLNFSIPNYISVNKLANLLNCRVER
LIKDLTALGFENITTTYILSKEYVELILQEYNFALPNLS
TSTNLDNVYDELKSPVNPKLLTKRAPVVTIMGHVDHGKT
TIIDYLRKSSVVAQEHGGITQHIGAFQITAPKSGKKITF
LDTPGHAAFLKMRERGANITDIIVLVVSVEDSLMPQTLE
AIKHAKNSGNEMIIAITKIDRIPQPKEREKKIEKVINDL
IVQGIPVEKIGGDVQVIPISA
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
One of the essential components for the initiation of protein synthesis. Protects formylmethionyl-tRNA from spontaneous hydrolysis and promotes its binding to the 30S ribosomal subunits. Also involved in the hydrolysis of GTP during the formation of the 70S ribosomal complex.
products references :
Mitochondrial translational-initiation and elongation factors in Saccharomyces cerevisiae.Vambutas A., Ackerman S.H., Tzagoloff A.Eur. J. Biochem. 201:643-652(1991) The nucleotide sequence of Saccharomyces cerevisiae chromosome XV.Dujon B., Albermann K., Aldea M., Alexandraki D., Ansorge W., Arino J., Benes V., Bohn C., Bolotin-Fukuhara M., Bordonne R., Boyer J., Camasses A., Casamayor A., Casas C., Cheret G., Cziepluch C., Daignan-Fornier B., Dang V.-D., de Haan M., Delius H., Durand P., Fairhead C., Feldmann H., Gaillon L., Galisson F., Gamo F.-J., Gancedo C., Goffeau A., Goulding S.E., Grivell L.A., Habbig B., Hand N.J., Hani J., Hattenhorst U., Hebling U., Hernando Y., Herrero E., Heumann K., Hiesel R., Hilger F., Hofmann B., Hollenberg C.P., Hughes B., Jauniaux J.-C., Kalogeropoulos A., Katsoulou C., Kordes E., Lafuente M.J., Landt O., Louis E.J., Maarse A.C., Madania A., Mannhaupt G., Marck C., Martin R.P., Mewes H.-W., Michaux G., Paces V., Parle-McDermott A.G., Pearson B.M., Perrin A., Pettersson B., Poch O., Pohl T.M., Poirey R., Portetelle D., Pujol A., Purnelle B., Ramezani Rad M., Rechmann S., Schwager C., Schweizer M., Sor F., Sterky F., Tarassov I.A., Teodoru C., Tettelin H., Thierry A., Tobiasch E., Tzermia M., Uhlen M., Unseld M., Valens M., Vandenbol M., Vetter I., Vlcek C., Voet M., Volckaert G., Voss H., Wambutt R., Wedler H., Wiemann S., Winsor B., Wolfe K.H., Zollner A., Zumstein E., Kleine K.Nature 387:98-102(1997) ) Global analysis of protein expression in yeast.Ghaemmaghami S., Huh W.-K., Bower K., Howson R.W., Belle A., Dephoure N., O'Shea E.K., Weissman J.S.Nature 425:737-741(2003)
ncbi gi num :
6324550
ncbi acc num :
NP_014619.1
ncbi gb acc num :
NM_001183277.1
uniprot acc num :
P25038
ncbi mol weight :
97.9kD
ncbi pathways :
Translation Factors Pathway (198647)
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.2 mg (E-Coli)
price2 :
460
size3 :
0.5 mg (E-Coli)
price3 :
750
size4 :
1 mg (E-Coli)
price4 :
1180
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!